최소 단어 이상 선택하여야 합니다.
최대 10 단어까지만 선택 가능합니다.
다음과 같은 기능을 한번의 로그인으로 사용 할 수 있습니다.
NTIS 바로가기국가/구분 | United States(US) Patent 등록 |
---|---|
국제특허분류(IPC7판) |
|
출원번호 | US-0376731 (1995-01-20) |
발명자 / 주소 |
|
출원인 / 주소 |
|
인용정보 | 피인용 횟수 : 14 인용 특허 : 24 |
Disclosed are 1) osteogenic devices comprising a matrix containing osteogenic protein and methods of inducing endochondral bone growth in mammals using the devices; 2) amino acid sequence data, amino acid composition, solubility properties, structural features, homologies and various other data char
A method for producing an OP-1 protein comprising the step of transforming a cell with a vector having inserted therein a DNA sequence which encodes an amino acid sequence comprising LYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCC APTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH, culturing said ce
※ AI-Helper는 부적절한 답변을 할 수 있습니다.