Humanized antibodies and compositions for binding sphingosine-1-phosphate
원문보기
IPC분류정보
국가/구분
United States(US) Patent
등록
국제특허분류(IPC7판)
C07K-016/00
C12P-021/08
A61K-039/395
A61K-039/00
출원번호
US-0258346
(2008-10-24)
등록번호
US-8222373
(2012-07-17)
발명자
/ 주소
Sabbadini, Roger A.
Garland, William A.
Hansen, Genevieve
Jones, Steven Tarran
Williams, David Gareth
출원인 / 주소
Lpath, Inc.
대리인 / 주소
Acuity Law Group, P.C.
인용정보
피인용 횟수 :
0인용 특허 :
102
초록▼
The present invention relates to anti-S1P agents, particularly humanized monoclonal antibodies (and antigen binding fragments thereof) specifically reactive with S1P, compositions containing such antibodies (or fragments), and the use of such antibodies (or fragments), for example, to treat diseases
The present invention relates to anti-S1P agents, particularly humanized monoclonal antibodies (and antigen binding fragments thereof) specifically reactive with S1P, compositions containing such antibodies (or fragments), and the use of such antibodies (or fragments), for example, to treat diseases and conditions associated with aberrant levels of S1P.
대표청구항▼
1. An isolated humanized antibody that binds sphingosine-1-phosphate and comprises two heavy chains and two light chains, wherein: A. each heavy chain comprises a heavy chain variable domain comprising: (i) a sequence of amino acid residues having an amino acid sequence EVQLVQSGAEVKKPGESLKISCQSFGYIF
1. An isolated humanized antibody that binds sphingosine-1-phosphate and comprises two heavy chains and two light chains, wherein: A. each heavy chain comprises a heavy chain variable domain comprising: (i) a sequence of amino acid residues having an amino acid sequence EVQLVQSGAEVKKPGESLKISCQSFGYIFIDHTIHWMRQMPGQGLE WMGAISPRHDITKYNEMFRGQVTISADKSSSTAYLQWSSLKASDT AMYFCARGGFYGSTIWFDFWGQGTMVTVSS (SEQ ID NO: 32, residues 20-140, inclusive); or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of A(i), above, provided that in any event the heavy chain variable domain comprises a first complementarity determining region (CDR) comprising a sequence of amino acid residues DHTIH (SEQ ID NO: 13), a second CDR comprising a sequence of amino acid residues AISPRHDITKYNEMFRG (SEQ ID NO: 31), and a third CDR comprising a sequence of amino acid residues GGFYGSTIWFDF (SEQ ID NO: 15); andB. each light chain comprises a light chain variable domain comprising: (i) a sequence of amino acid residues having an amino acid sequence ETTVTQSPSFLSASVGDRVTITCITTTDIDDDMNWFQQEPG KAPKLLISEGNILRPGVPSRFSSSGYGTDFTLTISKLQPEDF ATYYCLQSDNLPFTFGQGTKLEIK (SEQ ID NO: 33, residues 21-127, inclusive); or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of B(i), above, provided that in any event the light chain variable domain comprises a first CDR comprising a sequence of amino acid residues ITTTDIDDDMN (SEQ ID NO: 10), a second CDR comprising a sequence of amino acid residues EGNILRP (SEQ ID NO: 11), and a third CDR comprising a sequence of amino acid residues LQSDNLPFT (SEQ ID NO: 12). 2. An isolated humanized antibody according to claim 1, wherein: A. each heavy chain comprises a sequence of amino acid residues having an amino acid sequence: (i) EVQLVQSGAEVKKPGESLKISCQSFGYIFIDHTIHWMRQM PGQGLEWMGAISPRHDITKYNEMFRGQVTISADKSSSTAYLQWSS LKASDTAMYFCARGGFYGSTIWFDFWGQGTMVTVSSASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK (SEQ ID NO: 35, residues 20-455, inclusive); or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of A(i), above, provided that in any event the heavy chain comprises a first complementarity determining region (CDR) comprising a sequence of amino acid residues DHTIH (SEQ ID NO: 13), a second CDR comprising a sequence of amino acid residues AISPRHDITKYNEMFRG (SEQ ID NO: 31), and a third CDR comprising a sequence of amino acid residues GGFYGSTIWFDF (SEQ ID NO: 15); andB. each light chain comprises a sequence of amino acid residues having an amino acid sequence: (i) ETTVTQSPSFLSASVGDRVTITCITTTDIDDDMNWFQQEPG KAPKLLISEGNILRPGVPSRFSSSGYGTDFTLTISKLQPEDFATYYCL QSDNLPFTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 37, residues 21-234, inclusive); or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of B(i), above, provided that in any event the light chain comprises a first CDR comprising a sequence of amino acid residues ITTTDIDDDMN (SEQ ID NO: 10), a second CDR comprising a sequence of amino acid residues EGNILRP (SEQ ID NO: 11), and a third CDR comprising a sequence of amino acid residues LQSDNLPFT (SEQ ID NO: 12). 3. An isolated humanized antibody according to claim 2, wherein each heavy chain comprises a sequence of amino acid residues having an amino acid sequence EVQLVQSGAEVKKPG ESLKISCQSFGYIFIDHTIHWMRQMPGQGLEWMGAISPRHDITKYNEMFRGQVTISADKS SSTAYLQWSSLKASDTAMYFCARGGFYGSTIWFDFWGQGTMVTVSSASTKGPSVFPLA PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG (SEQ ID NO: 38, residues 1-450, inclusive). 4. An isolated humanized antibody, according to claim 1 wherein at least one amino acid residue of the antibody is glycosylated. 5. A pharmaceutical composition comprising an isolated humanized antibody according to claim 1 and a pharmaceutically acceptable carrier. 6. An isolated humanized antibody that binds sphingosine-1-phosphate, wherein: A. each heavy chain comprises: i) an amino acid sequence that is the same as the amino acid sequence of the heavy chain encoded by the vector pATH1009 in ATCC Accession No. PTA-8421; or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of A(i), above, provided that in any event the heavy chain comprises a first complementarity determining region (CDR) comprising a sequence of amino acid residues DHTIH (SEQ ID NO: 13), a second CDR comprising a sequence of amino acid residues AISPRHDITKYNEMFRG (SEQ ID NO: 31), and a third CDR comprising a sequence of amino acid residues GGFYGSTIWFDF (SEQ ID NO: 15); andB. each light chain comprises: (i) an amino acid sequence that is the same as the amino acid sequence of the light chain encoded by the vector pATH1009 in ATCC Accession No. PTA-8421; or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of B(i), above, provided that in any event the light chain comprises a first CDR comprising a sequence of amino acid residues ITTTDIDDDMN (SEQ ID NO: 10), a second CDR comprising a sequence of amino acid residues EGNILRP (SEQ ID NO: 11), and a third CDR comprising a sequence of amino acid residues LQSDNLPFT (SEQ ID NO: 12). 7. An isolated humanized antibody according to claim 6 wherein at least one amino acid residue of the antibody is glycosylated. 8. A pharmaceutical composition comprising an isolated humanized antibody according to claim 6 and a pharmaceutically acceptable carrier.
Baker Joffre (El Granada CA) Chien Kenneth (La Jolla CA) King Kathleen (Pacifica CA) Pennice Diane (Burlingame CA) Wood William (San Mateo CA), Cardiac hypertrophy factor and uses therefor.
Sabbadini, Roger A., Compositions and methods for the treatment and prevention of cardiovascular diseases and disorders, and for identifying agents therapeutic therefor.
Sabbadini, Roger A., Compositions and methods for the treatment and prevention of cardiovascular diseases and disorders, and for identifying agents therapeutic therefor.
Igarashi Yasuyuki (Seattle WA) Ahmad Mahammad N. (Seattle WA) Okoshi Hirofumi (Seattle WA) Hakomori Sen-Itiroh (Mercer Island WA), Effect of N,N,N,-trimethylsphingosine on protein kinase C activity melanoma cell growth in vitro; metastatic potential i.
Handa Kazuko (Seattle WA) Igarashi Yasuyuki (Seattle WA) Ahmad Mahammad N. (Seattle WA) Hakomori Sen-Itiroh (Mercer Island WA), Effect of N,N,N-trimethylsphingosine on protein kinase-C activity, melanoma cell growth in vitro, metastatic potential i.
Kimura Satoshi (Seattle WA) Igarashi Yasuyuki (Seattle WA) Hakomori Sen-itiroh (Seattle WA) Ahmad Mohammad N. (Seattle WA) Okoshi Hirofumi (Seattle WA) Handa Kazuko (Seattle WA), Effect of N,N,N-trimethylsphingosine on protein kinase-C activity; melanoma cell growth in vitro; metastatic potential i.
Amtmann Eberhard,DEX ; Frank Norbert,DEX ; Sauer Gerhard,DEX ; Schilling Gerhard,DEX, Guanidine derivatives, methods of preparing them and their use as drugs.
Boguslaski Robert C. (Elkhart IN) Carrico Robert J. (Bremen IN) Christner James E. (Ann Arbor MI), Heterogenous specific binding assay employing a cycling reactant as label.
Philip R. Tempest GB; William J. Harris GB; Frank J. Carr GB, Humanized antibodies to Fc receptors for immunoglobulin G on human mononuclear phagocytes.
Queen Cary L. (Los Altos CA) Co Man Sung (Cupertino CA) Schneider William P. (Mountain View CA) Landolfi Nicholas F. (Milpitas CA) Coelingh Kathleen L. (San Francisco CA) Selick Harold E. (Belmont CA, Humanized immunoglobulins.
Woodle Martin C. (Menlo Park CA) Martin Francis J. (San Francisco CA) Yau-Young Annie (Los Altos CA) Redemann Carl T. (Walnut Creek CA), Liposomes with enhanced circulation time.
Zeeck Axel (Gttingen DEX) Thiericke Ralf (Gttingen DEX) Zhner Hans (Tbingen DEX) Dickneite Gerhard (Marburg DEX) Sedlacek Hans H. (Marburg DEX), Manumycin derivatives and the use thereof.
Mather Jennie P. (Millbrae CA) Tsao Mary C. (Burlingame CA), Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins.
Igarashi Yasuyuki ; Ruan Fugiang ; Sadahira Yoshito ; Kawa Shigeyuki ; Hakomori Sen-itiroh, Method for inhibition of cell motility by sphingosine-1-phosphate and its derivatives.
Tabas Ira ; Schissel Scott L. ; Williams Kevin Jon, Method for treating a subject suffering from a condition associated with an extracellular zinc sphingomyelinase.
Tabas, Ira; Schissel, Scott L.; Williams, Kevin Jon, Method for treating a subject suffering from conditions associated with an extracellular zinc sphingomyelinase.
Woodcock Elizabeth Anne,AUX ; Anderson Karen Elizabeth,AUX ; Dart Anthony Michael,AUX ; Du Xiao-Jun,AUX, Method for treating cardiac dysfunction and pharmaceutical compositions useful therefor.
Hannun Yusuf A. (Chapel Hill NC) Bielawska Alicja (Apex NC), Method of inducing cellular differentiations and altering cell phenotype using ceramide analogs.
Wei Yong (Branchburg NJ) Mayhew Eric (Monmouth Junction NJ) Ahmad Imran (Plainsboro NJ) Janoff Andrew S. (Yardley PA), Methods of treatment using pharmaceutically active ceramide-related compositions.
Chang Chung Nan ; Landolfi Nicholas F. ; Martin Ulrich,DEX, Monoclonal antibodies specific for the platelet derived growth factor .beta. receptor and methods of use thereof.
Boss Michael A. (Slough GBX) Kenten John H. (High Wycombe GBX) Emtage John S. (High Wycombe GBX) Wood Clive R. (Near Fordingbridge GBX), Multichain polypeptides or proteins and processes for their production.
Davis Frank F. (19 Farmingdale Rd. East Brunswick NJ 08816) Van Es Theodorus (313 Overbrook Rd. Piscataway NJ 08854) Palczuk Nicholas C. (45 W. Franklin St. Bound Brook NJ 08805), Non-immunogenic polypeptides.
Queen Cary L. (Los Altos CA) Schneider William P. (Mountain View CA) Selick Harold E. (Belmont CA), Polynucleotides encoding improved humanized immunoglobulins.
Holton Robert A. (Tallahassee FL), Preparation of substituted isoserine esters using b
상세보기
Surani Azim M. (Cambridge GB3) Neuberger Michael S. (Cambridge GB3) Bruggemann Marianne (Cambridge GB3), Production of antibodies from transgenic animals.
Hoogenboom Hendricus R. J. M. (Cambridge GBX) Baier Michael (Frankfurt DEX) Jespers Laurent S. A. T. (Tervuren BEX) Winter Gregory P. (Cambridge GBX), Production of chimeric antibodies - a combinatorial approach.
Cabilly Shmuel (Monrovia CA) Heyneker Herbert L. (Burlingame CA) Holmes William E. (Pacifica CA) Riggs Arthur D. (La Verne CA) Wetzel Ronald B. (San Francisco CA), Recombinant immunoglobin preparations.
Gamble, Jennifer; Vadas, Mathew; Xia, Pu; Barter, Phillip; Rye, Kerry-Anne; Wattenberg, Brian; Pitson, Stuart, Screening method for an agent having an effect on a sphingosine kinase signaling pathway.
※ AI-Helper는 부적절한 답변을 할 수 있습니다.