Methods for control of flux in metabolic pathways through enzyme relocation
원문보기
IPC분류정보
국가/구분
United States(US) Patent
등록
국제특허분류(IPC7판)
C12P-001/00
C12P-007/42
C12N-009/10
C12N-009/88
C12N-015/62
C12P-007/16
C12P-007/62
C12P-023/00
C12N-015/70
C12P-005/00
출원번호
US-0620054
(2015-02-11)
등록번호
US-10006062
(2018-06-26)
발명자
/ 주소
Swartz, James R.
출원인 / 주소
The Board of Trustees of the Leland Stanford Junior University
대리인 / 주소
Wolf, Greenfield & Sacks, P.C.
인용정보
피인용 횟수 :
0인용 특허 :
68
초록▼
Genetically manipulated cells, lysates of such cells, systems, and methods of use thereof are provided, where one or more enzymes in a pathway of interest are genetically modified to incorporate a peptide sequence that provides for relocation of the protein, e.g., to the periplasm, so as to sequeste
Genetically manipulated cells, lysates of such cells, systems, and methods of use thereof are provided, where one or more enzymes in a pathway of interest are genetically modified to incorporate a peptide sequence that provides for relocation of the protein, e.g., to the periplasm, so as to sequester the enzyme, and where the enzyme controls flux in the pathway of interest.
대표청구항▼
1. A bacterial cell that expresses enzymes of a biosynthetic pathway for production of a product, wherein at least one of the enzymes: (i) controls metabolic flux in the biosynthetic pathway;(ii) is modified by genetic means to attach a periplasmic-targeting sequence; and(iii) is selected from the g
1. A bacterial cell that expresses enzymes of a biosynthetic pathway for production of a product, wherein at least one of the enzymes: (i) controls metabolic flux in the biosynthetic pathway;(ii) is modified by genetic means to attach a periplasmic-targeting sequence; and(iii) is selected from the group consisting of amidophosphoribosyl transferase, orotate phosphoribosyltransferase, 2-dehydro-3-deoxyphosphoheptonate aldolase, phosphoribosyltransferase HisG, acetolactate/acetohydroxybutanoate synthase, UDP-N-acetylglucosamine acyltransferase, aspartate aminotransferase, arginine decarboxylase, GTP cyclohydrolase I, acetyl-CoA carboxylase, 2-keto-acid decarboxylase, acetyl-CoA acetyltransferase, and beta-ketothiolase,wherein the product is selected from the group consisting of antibiotics, biosurfactants, biological fuels, amino acids, organic acids, fatty acids, alcohols, polyols, flavors, fragrances, nucleotides, vitamins, pigments, sugars, polysaccharides, biopolymers, plastics, isoprenoids, terpenes, and cell metabolites. 2. The bacterial cell of claim 1, wherein in the bacterial cell at least one gene encoding the at least one modified enzyme is present on an episomal vector or a chromosome. 3. The bacterial cell of claim 1, wherein in the bacterial cell at least two enzymes in the biosynthetic pathway are modified by genetic means to include a periplasmic targeting sequence. 4. The bacterial cell of claim 1, wherein the periplasmic targeting sequence is a sequence selected from the group consisting of: (SEQ ID NO: 1)MKIKTGARILALSALTTMMFSASALA;(SEQ ID NO: 2)MKQSTIALALLPLLFTPVTKA;(SEQ ID NO: 3)MMITLRKLPLAVAVAAGVMSAQAMA;(SEQ ID NO: 4)MNKKVLTLSAVMASMLFGAAAHA;(SEQ ID NO: 5)MKYLLPTAAAGLLLLAAQPAMA;(SEQ ID NO: 6)MKKIWLALAGLVLAFSASA;(SEQ ID NO: 7)MMTKIKLLMLIIFYLIISASAHA;(SEQ ID NO: 8)MKQALRVAFGFLILWASVLHA;(SEQ ID NO: 9)MRVLLFLLLSLFMLPAFS; and(SEQ ID NO: 10)MANNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA. 5. A bacterial cell lysate of the bacterial cell of claim 1. 6. A method of producing a cell lysate composition for producing a product of a biosynthetic pathway of interest, the method comprising: (a) culturing bacterial cells of claim 1; and(b) lysing the cultured bacterial cells. 7. The method of claim 6, wherein in the bacterial cell at least two enzymes in the biosynthetic pathway are modified by genetic means to include a periplasmic targeting sequence. 8. The method of claim 6, wherein the step of culturing cells comprises culturing multiple cultures of cells. 9. The method of claim 6, wherein the step of lysing the cultured cells produces two or more lysates. 10. The method of claim 9 further comprising combining the two or more lysates. 11. The method of claim 6, wherein the step of culturing the cells comprises culturing the cells in cell growth medium that has been modified by the addition of a factor that increases or preserves the activity of the enzymes of the biosynthetic pathway. 12. The method of claim 6 further comprising combining the cell lysate with at least one substance selected from the group consisting of substrates, enzymes, nutrients, co-factors, buffers, reducing agents, and ATP generating systems; and incubating the cell lysate and the one or more substance for a period of time and under conditions sufficient to produce the product. 13. The method of claim 12, wherein in the bacterial cell at least two enzymes in the biosynthetic pathway are modified by genetic means to include a periplasmic targeting sequence. 14. The method of claim 12, wherein the step of culturing cells comprises culturing multiple cultures of cells. 15. The method of claim 12, wherein the step of lysing the cultured cells produces two or more lysates. 16. The method of claim 15 further comprising combining the two or more lysates. 17. The method of claim 12, wherein the step of culturing the cells comprises culturing the cells in cell growth medium that has been modified by the addition of a factor that increases or preserves the activity of the enzymes of the biosynthetic pathway.
연구과제 타임라인
LOADING...
LOADING...
LOADING...
LOADING...
LOADING...
이 특허에 인용된 특허 (68)
Kubo Katsuro (Fijisawa JPX) Fukagawa Yasuo (Kamakura JPX) Ishikura Tomoyuki (Chigasaki JPX), Amidohydrolase having ability to depantothenylate an antibiotic.
Kahan Jean S. (Rahway NJ) Kahan Frederick M. (Rahway NJ) Stapley Edward O. (Metuchen NJ) Goegelman Robert T. (Linden NJ) Hernandez Sebastian (Madrid ES), Antibiotics.
Hubbard Vance M. (Bedford) Brunson Welton K. (Bedford) Saied V. C. (Wichita Falls TX), Apparatus and method for raising a skin wheal and anesthetizing skin.
Swartz,James Robert; Boyer,Marcus Emil; Stapleton,James Alan; Spormann,Alfred M.; Wang,Chia Wei, Cell-free extracts and synthesis of active hydrogenase.
Condra Jon H. (Abington PA) Graham Donald J. (Green Lane PA) Gotlib Leah (Wynnewood PA), Color screening assay for identifying inhibitor resistant HIV protease mutants.
Salmond George Peacock Copeland,GBX ITX CU32 5Q7 ; McGowan Simon James,GBX ITX CU4 9FU ; Sebaihia Mohammed,GBX ITX CU3 5LX ; Cox Anthony Richard John,GBX ITX B93 0BP ; Holden Matthew Thomas Geoffrey,, Genes involved in the biosynthetic pathway of carbapenem.
Lilley Stephen J. (Sawston GBX) Taylor Hugh F. (Sawston GBX) Theobald David R. (Huntingdon GBX) Carlson Craig J. (Andover MA) Rosen David I. (Arlington MA) Johnson Thomas R. (Milford NH), Medical injection system and method, gas spring thereof and launching device using gas spring.
Cox Karen L. (Martinsville IN) Fishman Scott E. (Carmel IN) Hershberger Charles L. (New Palestine IN) Seno Eugene T. (Indianapolis IN), Method for increasing the antibiotic-producing ability of antibiotic-producing microorganisms.
Patel Ramesh N. (Edison NJ) Hou Ching-Tsang (Edison NJ) Laskin Allen I. (New York NY), Method for producing microbial cells and use thereof to produce oxidation products.
Choi Cha-yong (223-1301 ; Olympic Family Apt. ; 150 ; Munjeong 2-dong Songpa-gu Seoul KRX) Kim Dong-myung (Seoul KRX) Jung Gyoo-yeol (Seoul KRX), Method for producing protein in a cell-free system.
McKinnon ; Jr. Charles N. (Laguna Niguel CA) Peterson Steven F. (West Linn OR) Smith Paul E. (Tualatin OR) Nakagawa Takaaki (Tigard OR) Bartholomew Victor L. (Tigard OR), Needleless hypodermic injection device.
Peterson Steven F. (West Linn OR) McKinnon ; Jr. Charles N. (Laguna Niguel CA) Smith Paul E. (Tualatin OR) Nakagawa Takaaki (Tigard OR) Bartholomew Victor L. (Tigard OR), Needleless hypodermic injection methods and device.
Hazen George G. (Westfield NJ) Volante Ralph P. (East Windsor NJ) Wilson Kenneth E. (Westfield NJ), Process for the preparation of N-formimidoyl thienamycin and reagents therefor.
Liu Thomas M. H. (Westfield NJ) Reamer Robert A. (Bloomfield NJ) Shinkai Ichiro (Westfield NJ) Sletzinger Meyer (North Plainfield NJ), Process for the preparation of N-protected N-formimidoyl 2-aminoethanethiol.
Liu Thomas M. H. (Westfield NJ) Reamer Robert A. (Bloomfield NJ) Shinkai Ichiro (Westfield NJ) Sletzinger Meyer (North Plainfield NJ), Process for the preparation of N-protected N-formimidoyl 2-aminoethanethiol.
Ingolia Thomas D. (Indianapolis IN) Kovacevic Steven (Indianapolis IN) Miller James R. (Indianapolis IN) Skatrud Paul L. (Greenwood IN), Recombinant DNA expression vectors and DNA compounds that encode deacetoxycephalosporin C synthetase.
Ingolia Thomas D. (Indianapolis IN) Weigel Barbara J. (Indianapolis IN), Recombinant DNA expression vectors and DNA compounds that encode isopenicillin N synthetase from Streptomyces lipmani.
Christensen Burton G. (Metuchen NJ) Leanza William J. (Berkeley Heights NJ) Wildonger Kenneth J. (Somerville NJ), Substituted N-methylene derivatives of thienamycin.
Demain Arnold L. (Wellesley MA) Konomi Toshio (Kobe JPX) Baldwin Jack E. (Oxford GB2), Synthesis of isopenicillin derivatives in the absence of living cells.
Kahan Jean S. (Rahway NJ) Kahan Frederick M. (Rahway NJ) Stapley Edward O. (Metuchen NJ) Goegelman Robert T. (Linden NJ) Hernandez Sebastian (Madrid ES), Thienamycin production.
※ AI-Helper는 부적절한 답변을 할 수 있습니다.