Compositions and methods for treatment and detection of cancers
원문보기
IPC분류정보
국가/구분
United States(US) Patent
등록
국제특허분류(IPC7판)
C07K-016/44
G01N-033/574
C07K-016/30
C07K-016/18
A61K-039/00
출원번호
US-0798312
(2015-07-13)
등록번호
US-10150818
(2018-12-11)
발명자
/ 주소
Wong, Chi-Huey
Hsu, Tsui-Ling
Lou, Yi-Wei
Lin, Chih-Wei
Yeh, Shih-Chi
Wu, Chung-Yi
Wu, Han-Chung
출원인 / 주소
Academia Sinica
대리인 / 주소
Duane Morris, LLP
인용정보
피인용 횟수 :
0인용 특허 :
194
초록▼
Pharmaceutical composition comprising antibodies or antigen binding fragments thereof that bind to globo H, SSEA3, and SSEA-4 are disclosed herein, as well as methods of use thereof. Methods of use include, without limitation, cancer therapies and diagnostics. The antibodies of the disclosure can bi
Pharmaceutical composition comprising antibodies or antigen binding fragments thereof that bind to globo H, SSEA3, and SSEA-4 are disclosed herein, as well as methods of use thereof. Methods of use include, without limitation, cancer therapies and diagnostics. The antibodies of the disclosure can bind to certain cancer cell surfaces. Exemplary targets of the antibodies disclosed herein can include carcinomas, such as those in brain, skin, bone, lungs, breast, esophagus, stomach, liver, bile duct, pancreas, colon, kidney, cervical, ovarian, and/or prostate cancer.
대표청구항▼
1. An isolated humanized monoclonal antibody that specifically binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3 Galα1→4Galβ1→4Glcβ1, wherein the antibody comprises an H-CDR1, an H-CDR2, an H-CDR3, an L-CDR1, an L-CDR2, and an L-CDR3 wherein (i) the H-CDR1 comprises the sequence of SEQ ID NO:152 (GFSLTSYG);(ii)
1. An isolated humanized monoclonal antibody that specifically binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3 Galα1→4Galβ1→4Glcβ1, wherein the antibody comprises an H-CDR1, an H-CDR2, an H-CDR3, an L-CDR1, an L-CDR2, and an L-CDR3 wherein (i) the H-CDR1 comprises the sequence of SEQ ID NO:152 (GFSLTSYG);(ii) the H-CDR2 comprises the sequence of SEQ ID NO: 153 (IWGEGST);(iii) the H-CDR3 comprises the sequence of SEQ ID NO:154 (AMTGTAY);(iv) the L-CDR1 comprises the sequence of SEQ ID NO: 149 (SSVSY);(v) the L-CDR2 comprises the sequence of SEQ ID NO:150 (DTS); and(vi) the L-CDR3 comprises the sequence of SEQ ID NO: 151(HQWSSSPHT). 2. The isolated humanized monoclonal antibody of claim 1, wherein the antibody is an IgG. 3. The isolated humanized monoclonal antibody of claim 2, wherein the antibody is an IgG1. 4. The isolated humanized monoclonal antibody of claim 1, wherein the antibody is a glycoantibody and wherein the glycoantibody comprises an N-glycan attached to the Asn-297 of the Fc region of said antibody wherein the N-glycan consists of the structure of Sia2(α2-6)Gal2GlcNAc2Man3GlcNAc2 and wherein the glycoantibody specifically binds to an SSEA-4 antigen. 5. The isolated humanized monoclonal antibody of claim 1, wherein the antibody comprises a VH having SEQ ID NO: 147 and a VL having SEQ ID No: 148 or a VH having SEQ ID No:137 and a VL having SEQ ID No:138. 6. A pharmaceutical composition comprising the antibody according to claim 1. 7. An antigen binding fragment of the isolated humanized monoclonal antibody of claim 1. 8. The antigen binding fragment of claim 7, wherein the antigen-binding fragment is an Fab fragment, an F(ab′)2 fragment, or a single-chain Fv fragment. 9. The isolated humanized monoclonal antibody of claim 1 wherein the antibody comprises an H-FR1, an H-FR2, an H-FR3, an H-FR4, an L-FR1, an L-FR2, an L-FR3, and an L-FR4 wherein, (i) the H-FR1 comprises the sequence of SEQ ID NO:159 (QVQLKESGPGLVAPSQSLSITCTVS);(ii) the H-FR2 comprises the sequence of SEQ ID NO:160 (VSWIRQPPGKGLEWIGV);(iii) the H-FR3 comprises the sequence of SEQ ID NO:161 (NYHSVLISRLTISKDNSKSQVFLKLNSLQTDDTATYYC);(iv) the H-FR4 comprises the sequence of SEQ ID NO:162 (WGQGTLVTVSS);(v) the L-FR1 comprises the sequence of SEQ ID NO: 155 (QIVLTQSPAIMSASPGEKVTMTCSAS);(vi) the L-FR2 comprises the sequence of SEQ ID NO:156 (MHWYQQKSGTSPKRWIY);(vii) the L-FR3 comprises the sequence of SEQ ID NO: 157 (KLSSGVPGRFSGSGSGTSYSLTISRLEAEDAATYYC); and(viii) the L-FR4 comprises the sequence of SEQ ID NO: 158 (FGGGTKVEIKR).
연구과제 타임라인
LOADING...
LOADING...
LOADING...
LOADING...
LOADING...
이 특허에 인용된 특허 (194)
Withers, Stephen; Watts, Andrew Graham; Kim, Jin Hyo; Wennekes, Tom, 2,3-fluorinated glycosides as neuraminidase inhibitors and their use as anti-virals.
Withers, Stephen; Watts, Andrew Graham; Kim, Jin Hyo; Wennekes, Tom, 2,3-fluorinated glycosides as neuraminidase inhibitors and their use as anti-virals.
King C. Richter (Washington DC) Kasprzyk Philip G. (Washington DC) Bird Robert E. (Rockville MD), Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof.
Senter Peter D. (Seattle WA) Saulnier Mark G. (Middletown CT) Brown Joseph P. (Seattle WA) Kerr David E. (Seattle WA), Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells.
Alvarez Vernon L. (Morrisville PA) Rodwell John D. (Yardley PA) Lee Chyi (New Brunswick NJ) Goers John W. F. (Atascadero CA) Siegel Richard C. (Yorktown Heights NY) McKearn Thomas J. (New Hope PA), Antibody-metal ion complexes.
McGahren William J. (Demarest NJ) Sassiver Martin L. (Spring Valley NY) Ellestad George A. (Pearl River NY), Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group.
Lee May D. (Monsey NY) Greenstein Michael (Suffern NY) Labeda David P. (Peoria IL) Fantini Amedeo A. (New City NY), Antitumor antibiotics (LL-E33288 complex).
Hubbard Vance M. (Bedford) Brunson Welton K. (Bedford) Saied V. C. (Wichita Falls TX), Apparatus and method for raising a skin wheal and anesthetizing skin.
Coughlin Daniel J. (Robbinsville NJ) Belinka ; Jr. Benjamin A. (Kendall Park NJ), Bifunctional isothiocyanate derived thiocarbonyls as ligands for metal binding.
Gentile Frank T. ; Winn Shelley R. ; Lysaght Michael ; Baurmeister Ulrich,DEX ; Wechs Friedbert,DEX ; Rottger Henning,DEX, Bioartificial organ containing cells encapsulated in a permselective polyether suflfone membrane.
Bosslet Klaus (Marburg DEX) Hermentin Peter (Marburg DEX) Seemann Gerhard (Marburg DEX) Kuhlmann Ludwig (Florsheim am Main DEX) Steinstrasser Axel (Liederbach DEX), Bispecific and oligospecific mono-and oligovalent receptors, the preparation and use thereof.
Robinson Randy R. (Los Angeles CA) Liu Alvin Y. (Santa Monica CA) Ledbetter Jeffrey A. (Seattle WA), Chimeric antibody with specificity to human B cell surface antigen.
Robinson Randy R. (Walnut Creek CA) Liu Alvin Y. (Seattle WA) Ledbetter Jeffrey A. (Seattle WA), Chimeric antibody with specificity to human B cell surface antigen.
Carpenter Richard S. (Cincinnati OH) Goldstein Irwin J. (Ann Arbor MI) Lad Pushkaraj J. (San Mateo CA) Wolff Ann M. (Cincinnati OH), Cleaning composition containing a type II endoglycosidase.
Mercep,Mladen; Mesic,Milan; Tomaskovic,Linda; Markovic,Stribor, Compounds, compositions as carriers for steroid/nonsteroid anti-inflammatory; antienoplastic and antiviral active molecules.
Hamann Philip Ross ; Hinman Lois ; Hollander Irwin ; Holcomb Ryan ; Hallett William ; Tsou Hwei-Ru ; Weiss Martin J., Conjugates of methyltrithio antitumor agents and intermediates for their synthesis.
Chari Ravi J. (Boston MA) Goldmacher Victor S. (Newton Center MA) Lambert John M. (Cambridge MA) Blattler Walter A. (Brookline MA), Cytotoxic agents comprising maytansinoids and their therapeutic use.
Chari Ravi J. (Boston MA) Goldmacher Victor S. (Newton Center MA) Lambert John M. (Cambridge MA) Blattler Walter A. (Brookline MA), Cytotoxic agents comprising maytansinoids and their therapeutic use.
Winter Gregory Paul (Cambridge GB3) Duncan Alexander Robert (Wimbledon GBX) Burton Dennis Raymond (Sheffield GB3), DNA encoding antibodies with altered effector functions.
Descamps,Val챕rie; Klarszinsky,Olivier; Barbeyron,Tristan; Cloarec,Bernard; Fritig,Bernard; Joubert,Jean Marie; Plesse,Bertrand; Yvin,Jean Claude, Endofucanases and method using same for preparing fuco-oligosaccharides from fucanes, bacterium producing endofucanases and uses of fuco-oligosaccharides for plant protection.
Hamann Philip Ross ; Hinman Lois ; Hollander Irwin ; Holcomb Ryan ; Hallett William ; Tsou Hwei-Ru ; Weiss Martin J., Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents.
Danishefsky, Samuel J.; Coltart, Don M.; Keding, Stacy J.; Biswas, Kaustav; Livingston, Philip O.; Ragupathi, Govindaswami; Allen, Jennifer R.; Williams, Lawrence, Glycoconjugates, glycoamino acids, intermediates thereto, and uses thereof.
Pettit George R. (Paradise Valley AZ) Srirangam Jayaram K. (Tempe AZ) Kantoci Darko (Redlands CA), Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides.
Tsukamoto Ann (Palo Alto CA) Baum Charles M. (Menlo Park CA) Aihara Yukoh (Hiratsuka CA JPX) Weissman Irving (Palo Alto CA), Human hematopoietic stem cell.
Queen Cary L. (Los Altos CA) Co Man Sung (Cupertino CA) Schneider William P. (Mountain View CA) Landolfi Nicholas F. (Milpitas CA) Coelingh Kathleen L. (San Francisco CA) Selick Harold E. (Belmont CA, Humanized immunoglobulins.
Kozarich John W. (Cambridge MA) Musso Gary F. (Hopkington MA) Malfroy-Camine Bernard (Arlington MA), Increasing blood-brain barrier permeability with permeabilizer peptides.
Kozarich John W. (Cambridge MA) Musso Gary F. (Hopkinton MA) Malfroy-Camine Bernard (Arlington MA), Increasing blood-brain barrier permeability with permeabilizer peptides.
Kozarich John W. (Cambridge MA) Musso Gary F. (Hopkinton MA) Malfroy-Camine Bernard (Arlington MA), Increasing blood-brain barrier permeability with permeabilizer peptides.
Clarence J. Maring ; Yu Gui Gu ; Hui-Ju Chen ; Yuanwei Chen ; David A. Degoey ; William J. Flosi ; Vincent L. Giranda ; David J. Grampovnik ; Warren M. Kati ; Dale J. Kempf ; April Kennedy , Inhibitors of neuraminidases.
Hamann Philip Ross ; Hinman Lois ; Hollander Irwin ; Holcomb Ryan ; Hallett William ; Tsou Hwei-Ru ; Weiss Martin J., Linkers useful for the synthesis of conjugates of methyltrithio antitumor agents.
Lilley Stephen J. (Sawston GBX) Taylor Hugh F. (Sawston GBX) Theobald David R. (Huntingdon GBX) Carlson Craig J. (Andover MA) Rosen David I. (Arlington MA) Johnson Thomas R. (Milford NH), Medical injection system and method, gas spring thereof and launching device using gas spring.
Mather Jennie P. (Millbrae CA) Tsao Mary C. (Burlingame CA), Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins.
Tice Thomas R. ; Gilley Richard M. ; Eldridge John H. ; Staas Jay K., Method for delivering bioactive agents into and through the mucosally associated lymphoid tissues and controlling their.
Tice Thomas R. ; Gilley Richard M. ; Eldridge John H. ; Staas Jay K., Method for delivering bioactive agents into and through the mucosally-associated lymphoid tissue and controlling their r.
Tice Thomas R. ; Gilley Richard M. ; Eldridge John H. ; Staas Jay K., Method for delivering bioactive agents into and through the mucosally-associated lymphoid tissues and controlling their.
Malfroy-Camine Bernard (Arlington MA), Method for increasing blood-brain barrier permeability by administering a bradykinin agonist of blood-brain barrier perm.
Kuntsmann Martin P. ; Hollander Irwin ; Hamann Philip, Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates.
Freedman Bernard (Peoria IL) Powell Richard G. (Peoria IL) Smith ; Jr. Cecil R. (Dunlap IL), Method of controlling the European corn borer with trewiasine.
Tice Thomas R. (Birmingham AL) Gilley Richard M. (Birmingham AL) Eldridge John H. (Birmingham AL) Staas Jay K. (Birmingham AL) Hollingshead Melinda G. (Birmingham AL) Shannon William M. (Birmingham A, Method of potentiating an immune response.
Gay, Robert D.; Sunstrom, Noelle-Anne; Gray, Peter Philip, Method of screening multiply transformed cells using bicistronic expression of fluorescent proteins.
Steeves, Rita M.; Chari, Ravi V. J.; Blättler, Walter A., Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates.
Johnson Kevin Stuart,GBX ; Winter Gregory Paul,GBX ; Griffiths Andrew David,GBX ; Smith Andrew John Hammond,GBX ; Waterhouse Peter Michael,AUX, Methods for producing members of specific binding pairs.
Kunstmann Martin P. ; Hollander Irwin J. ; Hamann Philip ; Kunz Arthur, Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates.
Mirkin, Chad A.; Letsinger, Robert L.; Mucic, Robert C.; Storhoff, James J.; Elghanian, Robert; Taton, Thomas A., Nanoparticles having oligonucleotides attached thereto and uses therefor.
McKinnon ; Jr. Charles N. (Laguna Niguel CA) Peterson Steven F. (West Linn OR) Smith Paul E. (Tualatin OR) Nakagawa Takaaki (Tigard OR) Bartholomew Victor L. (Tigard OR), Needleless hypodermic injection device.
Peterson Steven F. (West Linn OR) McKinnon ; Jr. Charles N. (Laguna Niguel CA) Smith Paul E. (Tualatin OR) Nakagawa Takaaki (Tigard OR) Bartholomew Victor L. (Tigard OR), Needleless hypodermic injection methods and device.
Withers, Stephen; Watts, Andrew Graham; Kim, Jin Hyo; Wennekes, Tom, Neuraminidase inhibitor compounds, compositions and methods for the use thereof in anti-viral treatments.
Withers, Stephen; Watts, Andrew Graham; Kim, Jin Hyo; Wennekes, Tom, Neuraminidase inhibitor compounds, compositions and methods for the use thereof in anti-viral treatments.
Ermak Thomas H. (Cambridge MA) Pappo Jacques (Cambridge MA) Guirakhoo Farshad (Cambridge MA) Nichols ; Jr. Richard D. (Cambridge MA) Monath Thomas P. (Cambridge MA) Roy Polly (Oxford GB2), Oral immunization with multiple particulate antigen delivery system.
Hyon Suong-Hyu (Uji JPX) Ikada Yoshita (Uji JPX), Polylactic acid type microspheres containing physiologically active substance and process for preparing the same.
Capon Daniel J. (San Mateo CA) Lawn Richard M. (San Francisco CA) Levinson Arthur D. (Hillsborough CA) Vehar Gordon A. (San Carlos CA) Wood William I. (San Mateo CA), Preparation of functional human factor VIII in mammalian cells using methotrexate based selection.
Hamann Philip Ross ; Hinman Lois ; Hollander Irwin ; Holcomb Ryan ; Hallett William ; Tsou Hwei-Ru ; Weiss Martin J., Process for preparing conjugates of methyltrithio antitumor agents.
McGahren William James ; Sassiver Martin Leon ; Ellestad George A. ; Hamann Philip R. ; Hinman Lois M. ; Upeslacis Janis, Process for preparing targeted forms of methyltrithio antitumor agents.
Surani Azim M. (Cambridge GB3) Neuberger Michael S. (Cambridge GB3) Bruggemann Marianne (Cambridge GB3), Production of antibodies from transgenic animals.
Hoogenboom Hendricus R. J. M. (Cambridge GBX) Baier Michael (Frankfurt DEX) Jespers Laurent S. A. T. (Tervuren BEX) Winter Gregory P. (Cambridge GBX), Production of chimeric antibodies - a combinatorial approach.
Georgiou George (Austin TX) Baneyx Francois (Thenon FRX), Protease-deficient bacterial strains for production of proteolytically sensitive polypeptides.
Wong, Chi-Huey; Liang, Pi-Hui, Quantitative analysis of carbohydrate-protein interactions using glycan microarrays: determination of surface and solution dissociation constants.
Howley Peter M. (Bethesda MD) Sarver Nava (Bethesda MD) Law Ming-Fan (Germantown MD), Recombinant DNA process utilizing a papilloma virus DNA as a vector.
Wels Winfried S. (Basel CHX) Hynes Nancy E. (Basel CHX) Harweth Ina-Maria (Grenzach-Wyhlen DEX) Groner Bernd (Basel CHX) Hardman Norman (Riehen CHX) Zwickl Markus (Basel CHX), Recombinant antibodies specific for a growth factor receptor.
Cabilly Shmuel (Monrovia CA) Heyneker Herbert L. (Burlingame CA) Holmes William E. (Pacifica CA) Riggs Arthur D. (La Verne CA) Wetzel Ronald B. (San Francisco CA), Recombinant immunoglobin preparations.
Wong, Chi-Huey; Hsu, Tsui-Ling; Hanson, Sarah R, Tailored glycoproteomic methods for the sequencing, mapping and identification of cellular glycoproteins.
Ellestad George A. (Pearl River NY) McGahren William J. (Demarest NJ) Sassiver Martin L. (Spring Valley NY) Hamann Philip R. (Garnerville NY) Hinman Lois M. (Tarrytown NY) Upeslacis Janis (Pomona NY), Targeted forms of methyltrithio antitumor agents.
Anderson Darrell R. ; Hanna Nabil ; Leonard John E. ; Newman Roland A. ; Reff Mitchell E. ; Rastetter William H., Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen.
Lonberg Nils (San Francisco CA) Kay Robert M. (San Francisco CA), Transgenic non-human animals capable of producing heterologous antibodies of various isotypes.
Lonberg Nils (San Francisco CA) Kay Robert M. (San Francisco CA), Transgenic non-human animals capable of producing heterologous antibodies of various isotypes.
Daynes Raymond A. (Park City UT) Araneo Barbara A. (Salt Lake City UT), Vaccine compositions and method for induction of mucosal immune response via systemic vaccination.
※ AI-Helper는 부적절한 답변을 할 수 있습니다.