[특허]Use of anti-sphingosine-1-phosphate antibodies in combination with chemotherapeutic agents

[미국특허] Use of anti-sphingosine-1-phosphate antibodies in combination with chemotherapeutic agents 원문보기

IPC분류정보
국가/구분	United States(US) Patent 등록
국제특허분류(IPC7판)	A61K-039/395 A61K-039/00 C07K-016/00 C12P-021/08
출원번호	US-0690033 (2010-01-19)
등록번호	US-8361465 (2013-01-29)
발명자 / 주소	Sabbadini, Roger A. Garland, William A.
출원인 / 주소	Lpath, Inc.
인용정보	피인용 횟수 : 0 인용 특허 : 102

초록

The present invention relates to use of anti-S1P antibodies in combination with chemotherapeutic agents for treatment and/or prevention of cancer, tumor growth, metastasis and/or growth of metastatic tumors.

대표청구항 ▼

1. A method selected from the group consisting of: a. a method for treating a cancer associated with sphingosine-1-phosphate (S1P), comprising administering to an animal suffering from cancer a chemotherapeutic agent and an antibody or antigen-binding antibody fragment that neutralizes S1P and thereby treat the cancer;b. a method for inhibiting tumor growth in an animal having a tumor associated with S1P, comprising administering to the animal a chemotherapeutic agent and an antibody or antigen-binding antibody fragment that neutralizes S1P and thereby inhibit growth of the tumor;c. a method for inhibiting tumor metastasis in an animal having a tumor associated with S1P, comprising administering to the animal a chemotherapeutic agent and an antibody or antigen-binding antibody fragment that neutralizes S1P and thereby inhibit metastasis of the tumor; andd. a method for inhibiting the growth of metastatic tumors in an animal having a cancer associated with S1P, comprising administering to the animal a chemotherapeutic agent and an antibody or antigen-binding antibody fragment that neutralizes S1P and thereby inhibit growth of metastatic tumors; wherein said antibody or antigen-binding antibody fragment in any of parts (a)-(d) comprises: (1) a light chain variable domain comprising: (i) a first sequence of amino acid residues of sequence ITTTDIDDDMN (SEQ ID NO: 10); (ii) a second sequence of amino acid residues EGNILRP (SEQ ID NO: 11); and (iii) a third sequence of amino acid residues of sequence LQSDNLPFT (SEQ ID NO: 12); and (2) a heavy chain variable domain comprising: (i) a first sequence of amino acid residues of sequence DHTIH (SEQ ID NO: 13); (ii) a second sequence of amino acid residues of sequence AISPRHDITKYNEMFRG (SEQ ID NO: 16); and (iii) a third sequence of amino acid residues of sequence GGFYGSTIWFDF (SEQ ID NO: 15). 2. A method according to claim 1 wherein the chemotherapeutic agent is an antimitotic agent. 3. A method according to claim 1 wherein the animal is a human. 4. A method according to claim 1 wherein the chemotherapeutic agent is administered in a first composition and the antibody targeted S1P is administered in a second composition. 5. A method according to claim 1 that further comprises surgery and/or radiation to treat cancer. 6. A method according to claim 1 wherein said antibody or antigen-binding antibody fragment in any of parts (a)-(d) comprises: (1) a light chain variable domain comprising:ETTVTQSPSFLSASVGDRVTITCITTTDIDDDMNWFQQEPGKAPKLLISEGNI LRPGVPSRFSSSGYGTDFTLTISKLQPEDFATYYCLQSDNLPFTFGQGTKLEI K (SEQ ID NO: 18, residues 21-127, inclusive); and(2) a heavy chain variable domain comprising:EVQLVQSGAEVKKPGESLKISCQSFGYIFIDHTIHWMRQMPGQGLEWM GAISPRHDITKYNEMFRGQVTISADKSSSTAYLQWSSLKASDTAMYFCA RGGFYGSTIWFDFWGQGTMVTVSS (SEQ ID NO: 17, residues 20-140, inclusive). 7. A method according to claim 1 wherein said antibody or antigen-binding antibody fragment in any of parts (a)-(d) comprises: (a) a light chain comprising:ETTVTQSPSFLSASVGDRVTITCITTTDIDDDMNWFQQEPGKAPKLLISEGNI LRPGVPSRFSSSGYGTDFTLTISKLQPEDFATYYCLQSDNLPFTFGQGTKLEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFNRGEC (SEQ ID NO: 24, residues 21-234, inclusive); and(b)(1) a heavy chain comprising:EVQLVQSGAEVKKPGESLKISCQSFGYIFIDHTIHWMRQMPGQGLEWMGAI SPRHDITKYNEMFRGQVTISADKSSSTAYLQWSSLKASDTAMYFCARGGF YGSTIWFDFWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 22, residues 20-455, inclusive); or(b)(1) a heavy chain as recited in part (b)(1) but lacking a C-terminal lysine residue.

이 특허에 인용된 특허 (102) 인용/피인용 타임라인 분석

Winter, Gregory Paul, Altered antibodies.
상세보기
Shayman James A. ; Radin Norman S., Amino ceramide-like compounds and therapeutic methods of use.
상세보기
Winter Gregory P. (Cambridge GB3) Duncan Alexander R. (Wimbledon GB3) Burton Dennis R. (Sheffield GB3), Antibodies with altered effector functions.
상세보기
Man Sung Co ; David A. Scheinberg ; Cary L. Queen, Antibodies with increased binding affinity.
상세보기
Philip E. Thorpe ; Rolf A. Brekken, Antibody conjugate compositions for selectively inhibiting VEGF.
상세보기
Weiner George ; Gingrich Roger ; Link Brian K. ; Tso J. Yun, Bispecific antibody effective to treat B-cell lymphoma and cell line.
상세보기
Tso J. Yun ; Kostelny Sheri A. ; Cole Michael S., Bispecific antibody heterodimers.
상세보기
Iwashita Yuji (Kawasaki JPX) Ajisaka Katsumi (Yokohama JPX), Blood substitute containing modified hemoglobin.
상세보기
Baker Joffre (El Granada CA) Chien Kenneth (La Jolla CA) King Kathleen (Pacifica CA) Pennice Diane (Burlingame CA) Wood William (San Mateo CA), Cardiac hypertrophy factor and uses therefor.
상세보기
Darfler Frederick J. (Derwood MD), Cell culture medium with antioxidant.
상세보기
Seidman Jonathan G. (Milton MA) Jakobovits Aya (Menlo Park CA), Cells homozygous for disrupted target loci.
상세보기
Nakagawa Yasushi (Kawanishi JPX) Ito Takashi (Osaka JPX), Chemically modified protein with polyethyleneglycol.
상세보기
Chun Jerold J. M. ; Hecht Jonathan H., Cloned lysophosphatidic acid receptors.
상세보기
Sabbadini, Roger, Compositions and methods for early detection of heart disease.
상세보기
Sabbadini,Roger A., Compositions and methods for the treatment and prevention of cancer, angiogenesis, and inflammation.
상세보기
Sabbadini, Roger A., Compositions and methods for the treatment and prevention of cardiovascular diseases and disorders, and for identifying agents therapeutic therefor.
상세보기
Sabbadini, Roger A., Compositions and methods for the treatment and prevention of cardiovascular diseases and disorders, and for identifying agents therapeutic therefor.
상세보기
Carson Dennis A. ; Cottam Howard, Compounds for inhibition of ceramide-mediated signal transduction.
상세보기
Mitra Gautam (Kensington CA), Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer.
상세보기
Igarashi Yasuyuki (Seattle WA) Ahmad Mahammad N. (Seattle WA) Okoshi Hirofumi (Seattle WA) Hakomori Sen-Itiroh (Mercer Island WA), Effect of N,N,N,-trimethylsphingosine on protein kinase C activity melanoma cell growth in vitro; metastatic potential i.
상세보기
Handa Kazuko (Seattle WA) Igarashi Yasuyuki (Seattle WA) Ahmad Mahammad N. (Seattle WA) Hakomori Sen-Itiroh (Mercer Island WA), Effect of N,N,N-trimethylsphingosine on protein kinase-C activity, melanoma cell growth in vitro, metastatic potential i.
상세보기
Kimura Satoshi (Seattle WA) Igarashi Yasuyuki (Seattle WA) Hakomori Sen-itiroh (Seattle WA) Ahmad Mohammad N. (Seattle WA) Okoshi Hirofumi (Seattle WA) Handa Kazuko (Seattle WA), Effect of N,N,N-trimethylsphingosine on protein kinase-C activity; melanoma cell growth in vitro; metastatic potential i.
상세보기
Lerner Richard (La Jolla CA) Janda Kim (San Diego CA) Brenner Sydney (Cambridge GB2), Encoded combinatorial chemical libraries.
상세보기
Amtmann Eberhard,DEX ; Frank Norbert,DEX ; Sauer Gerhard,DEX ; Schilling Gerhard,DEX, Guanidine derivatives, methods of preparing them and their use as drugs.
상세보기
Iwasaki Keiji (Kawasaki JPX) Iwashita Yuji (Kawasaki JPX) Okami Taketoshi (Yokohama JPX), Hemoglobin combined with a poly(alkylene oxide).
상세보기
Boguslaski Robert C. (Elkhart IN) Carrico Robert J. (Bremen IN) Christner James E. (Ann Arbor MI), Heterogenous specific binding assay employing a cycling reactant as label.
상세보기
Tsui Ping, Human EDG3sb gene.
상세보기
Barbas, III,Carlos F.; Rader,Christoph, Humanization of murine antibody.
상세보기
Goldstein,Neil I.; Giorgio,Nicholas A.; Jones,Steven Tarran; Saldanha,Jose William, Humanized anti-EGF receptor monoclonal antibody.
상세보기
Lin Augustine Y., Humanized antibodies and uses thereof.
상세보기
Co Man Sung ; Tso J. Yun, Humanized antibodies reactive with GPIIB/IIIA.
상세보기
Co Man Sung, Humanized antibodies reactive with L-selectin.
상세보기
Vasquez Maximiliano ; Landolfi Nicholas F. ; Tsurushita Naoya ; Queen Cary L., Humanized antibodies to .gamma.-interferon.
상세보기
Philip R. Tempest GB; William J. Harris GB; Frank J. Carr GB, Humanized antibodies to Fc receptors for immunoglobulin G on human mononuclear phagocytes.
상세보기
Wayne A. Marasco ; Joyce Lavecchio ; Abner Mhashilkar ; Urban Ramstedt ; David Ring ; Bridget Eberhardt ; Julie Porter-Brooks, Humanized antibody and uses thereof.
상세보기
Queen Cary L. (Los Altos CA) Co Man Sung (Cupertino CA) Schneider William P. (Mountain View CA) Landolfi Nicholas F. (Milpitas CA) Coelingh Kathleen L. (San Francisco CA) Selick Harold E. (Belmont CA, Humanized immunoglobulins.
상세보기
Queen Cary L. (Los Altos CA) Selick Harold E. (Belmont CA), Humanized immunoglobulins.
상세보기
Queen Cary L. (Los Altos CA) Selick Harold E. (Belmont CA), Humanized immunoglobulins.
상세보기
Queen Cary L. ; Selick Harold E., Humanized immunoglobulins and methods of making the same.
상세보기
Smith David S. (London GB2), Immunoassay for gentamicin.
상세보기
David Gary S. (La Jolla CA) Greene Howard E. (Carlsbad CA), Immunometric assays using monoclonal antibodies.
상세보기
Goroff Diana K. (Chevy Chase MD), In-vitro method for producing antigen-specific human monoclonal antibodies.
상세보기
Co Man Sung ; Scheinberg David A. ; Queen Cary L., Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region.
상세보기
Bell Robert M. (Durham NC) Loomis Carson (Durham NC) Hannun Yusuf (Durham NC), Inhibition of protein kinase C by long-chain bases.
상세보기
Bell Robert M. (Durham NC) Loomis Carson (Durham NC) Hannun Yusuf (Durham NC), Inhibition of protein kinase C by long-chain bases.
상세보기
Hannun Yusuf A. ; Bielawska Alicja ; McKay Charles, Inhibitors of ceramidase.
상세보기
Sabbadini, Roger A., Kits for early detection of heart disease.
상세보기
Ryan, Patrick J.; Davis, Michael A.; Melchior, Donald L., Liposomes containing modified cholesterol for organ targeting.
상세보기
Woodle Martin C. (Menlo Park CA) Martin Francis J. (San Francisco CA) Yau-Young Annie (Los Altos CA) Redemann Carl T. (Walnut Creek CA), Liposomes with enhanced circulation time.
상세보기
Litman David J. (Palo Alto CA) Harel Zvi (Stanford CA) Ullman Edwin F. (Atherton CA), Macromolecular environment control in specific receptor assays.
상세보기
Munroe Donald G.,CAX ; Gupta Ashwani K.,CAX ; Vyas Tejal B.,CAX ; Chun Jerold J. M., Mammalian EDG-5 receptor homologs.
상세보기
Patel Pramathesh S. (Ringoes NJ) Shu Yue-Zhong (Cheshire CT), Manumycin compounds.
상세보기
Zeeck Axel (Gttingen DEX) Thiericke Ralf (Gttingen DEX) Zhner Hans (Tbingen DEX) Dickneite Gerhard (Marburg DEX) Sedlacek Hans H. (Marburg DEX), Manumycin derivatives and the use thereof.
상세보기
Mather Jennie P. (Millbrae CA) Tsao Mary C. (Burlingame CA), Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins.
상세보기
Igarashi Yasuyuki (Seattle WA) Ruan Fugiang (Seattle WA) Sadahira Yoshito (Seattle WA) Kawa Shigeyuki (Seattle WA) Hakomori Sen-itiroh (Seattle WA), Method for inhibition of cell motility by sphingosine-1-phosphate and derivatives.
상세보기
Igarashi Yasuyuki ; Ruan Fugiang ; Sadahira Yoshito ; Kawa Shigeyuki ; Hakomori Sen-itiroh, Method for inhibition of cell motility by sphingosine-1-phosphate and its derivatives.
상세보기
Igarashi Yasuyuki (Seattle WA) Ruan Fuqiang (Seattle WA) Sadahira Yoshito (Seattle WA) Kawa Shigeyuki (Seattle WA) Hakomori Sen-itiroh (Seattle WA), Method for inhibition of cell motility by sphingosine-1-phosphate, its derivatives and mimetics and method of synthesizi.
상세보기
Carter Paul J. ; Presta Leonard G. ; Ridgway John B., Method for making heteromultimeric polypeptides.
상세보기
Carter, Paul J.; Presta, Leonard G., Method for making humanized antibodies.
상세보기
Paul J. Carter ; Leonard G. Presta, Method for making humanized antibodies.
상세보기
Tabas Ira ; Schissel Scott L. ; Williams Kevin Jon, Method for treating a subject suffering from a condition associated with an extracellular zinc sphingomyelinase.
상세보기
Tabas, Ira; Schissel, Scott L.; Williams, Kevin Jon, Method for treating a subject suffering from conditions associated with an extracellular zinc sphingomyelinase.
상세보기
Woodcock Elizabeth Anne,AUX ; Anderson Karen Elizabeth,AUX ; Dart Anthony Michael,AUX ; Du Xiao-Jun,AUX, Method for treating cardiac dysfunction and pharmaceutical compositions useful therefor.
상세보기
Hannun Yusuf A. (Chapel Hill NC) Bielawska Alicja (Apex NC), Method of inducing cellular differentiations and altering cell phenotype using ceramide analogs.
상세보기
Igarashi Yasuyuki (Seattle WA) Ahmad Mahammad N. (Seattle WA) Okoshi Hirofumi (Seattle WA) Hakomori Sen-Itiroh (Mercer Island WA), Method of preparing N,N,N-trimethylsphingosine.
상세보기
Light Susan ; Queen Cary, Method of preventing acute rejection following solid organ transplantation.
상세보기
Borrebaeck Carl (Lund SEX) Danielsson Lena (Lund SEX) Moller Susanna (Lund SEX), Method of producing human monoclonal antibodies and kit therefor.
상세보기
Sabbadini Roger A., Methods for early detection of heart disease.
상세보기
MacLennan Alexander J. (7811 NW. 35th Pl. Gainesville FL 32606), Molecular cloning and expression of G-protein coupled receptors.
상세보기
Chang Chung Nan ; Landolfi Nicholas F. ; Martin Ulrich,DEX, Monoclonal antibodies specific for the platelet derived growth factor .beta. receptor and methods of use thereof.
상세보기
Boss Michael A. (Slough GBX) Kenten John H. (High Wycombe GBX) Emtage John S. (High Wycombe GBX) Wood Clive R. (Near Fordingbridge GBX), Multichain polypeptides or proteins and processes for their production.
상세보기
Tso J. Yun ; Cole Michael S. ; Anasetti Claudio, Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same.
상세보기
Davis Frank F. (19 Farmingdale Rd. East Brunswick NJ 08816) Van Es Theodorus (313 Overbrook Rd. Piscataway NJ 08854) Palczuk Nicholas C. (45 W. Franklin St. Bound Brook NJ 08805), Non-immunogenic polypeptides.
상세보기
Shimizu Kimihiro (Yoshikawa JPX) Nakahara Tsuguji (Tokyo JPX) Kinoshita Taketoshi (Koshigaya JPX) Takatsuka Jun (Kawasaki JPX) Igarashi Michiko (Musashino JPX), Plasminogen activator derivatives.
상세보기
Duckworth David Malcolm,GBX ; Godden Robert James,GBX ; Testa Tania Tamson,GBX, Polynucleotides encoding human sphingosine Lyase.
상세보기
Queen Cary L. (Los Altos CA) Schneider William P. (Mountain View CA) Selick Harold E. (Belmont CA), Polynucleotides encoding improved humanized immunoglobulins.
상세보기
Presta Leonard G. ; Snedecor Bradley R., Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life.
상세보기
Holton Robert A. (Tallahassee FL), Preparation of substituted isoserine esters using b 상세보기

IPC	Description
A	생활필수품
A62	인명구조; 소방(사다리 E06C)
A62B	인명구조용의 기구, 장치 또는 방법(특히 의료용에 사용되는 밸브 A61M 39/00; 특히 물에서 쓰이는 인명구조 장치 또는 방법 B63C 9/00; 잠수장비 B63C 11/00; 특히 항공기에 쓰는 것, 예. 낙하산, 투출좌석 B64D; 특히 광산에서 쓰이는 구조장치 E21F 11/00)
A62B-1/08	.. 윈치 또는 풀리에 제동기구가 있는 것

내보내기 구분	파일저장 인쇄 메일전송
구성항목	기본정보 상세정보 관리번호, 국가코드, 자료구분, 상태, 출원번호, 출원일자, 공개번호, 공개일자, 등록번호, 등록일자, 발명명칭(한글), 발명명칭(영문), 출원인(한글), 출원인(영문), 출원인코드, 대표IPC 관리번호, 국가코드, 자료구분, 상태, 출원번호, 출원일자, 공개번호, 공개일자, 공고번호, 공고일자, 등록번호, 등록일자, 발명명칭(한글), 발명명칭(영문), 출원인(한글), 출원인(영문), 출원인코드, 대표출원인, 출원인국적, 출원인주소, 발명자, 발명자E, 발명자코드, 발명자주소, 발명자 우편번호, 발명자국적, 대표IPC, IPC코드, 요약, 미국특허분류, 대리인주소, 대리인코드, 대리인(한글), 대리인(영문), 국제공개일자, 국제공개번호, 국제출원일자, 국제출원번호, 우선권, 우선권주장일, 우선권국가, 우선권출원번호, 원출원일자, 원출원번호, 지정국, Citing Patents, Cited Patents
저장형식	Text(ASCII format) Excel format PIAS분석(.xls)
메일정보	받는사람 (필수) @ 보내는사람 (선택) @ 제목 내용 KISTI 검색결과 이메일 서비스
안내	총 건의 자료가 검색되었습니다. 다운받으실 자료의 인덱스를 입력하세요. (1-10,000) 검색결과의 순서대로 최대 10,000건 까지 다운로드가 가능합니다. 데이타가 많을 경우 속도가 느려질 수 있습니다.(최대 2~3분 소요) 다운로드 파일은 UTF-8 형태로 저장됩니다. 파일의 내용이 제대로 보이지 않을실 때는 웹브라우저 상단의 보기 -> 인코딩 -> 자동선택 여부를 확인하십시오. ~ Text(ASCII format) Excel format

연합인증

[미국특허] Use of anti-sphingosine-1-phosphate antibodies in combination with chemotherapeutic agents 원문보기

초록

대표청구항 ▼

연구과제 타임라인

이 특허에 인용된 특허 (102) 인용/피인용 타임라인 분석

활용도 분석정보

활용도 Top5 특허

관련 콘텐츠

특허 원문 보기

IPC 상위 출원인

AI-Helper ※ AI-Helper는 오픈소스 모델을 사용합니다.

선택된 텍스트

연합인증

[미국특허] Use of anti-sphingosine-1-phosphate antibodies in combination with chemotherapeutic agents 원문보기

초록

대표청구항 ▼

연구과제 타임라인

전체(0) 논문(0) 특허(0) 보고서(0)

전체(0) 논문(0) 특허(0) 보고서(0)

이 특허에 인용된 특허 (102) 인용/피인용 타임라인 분석

활용도 분석정보

활용도 Top5 특허 더보기

관련 콘텐츠

특허 원문 보기

IPC 상위 출원인

AI-Helper ※ AI-Helper는 오픈소스 모델을 사용합니다.

선택된 텍스트

활용도 Top5 특허