[논문]Human collagen alpha-2 type I stimulates collagen synthesis, wound healing, and elastin production in normal human dermal fibroblasts (HDFs)

Hwang, Su Jin; Ha, Geun-Hyoung; Seo, Woo-Young; Kim, Chung Kwon; Kim, KyeongJin; Lee, Sang Bae

doi:10.5483/bmbrep.2020.53.10.120

Human collagen alpha-2 type I stimulates collagen synthesis, wound healing, and elastin production in normal human dermal fibroblasts (HDFs) 원문보기

BMB reports, v.53 no.10, 2020년, pp.539 - 544

Hwang, Su Jin (ABIOTECH Co., Ltd.) , Ha, Geun-Hyoung (ABIOTECH Co., Ltd.) , Seo, Woo-Young (ABIOTECH Co., Ltd.) , Kim, Chung Kwon (Department of Anatomy and Cell Biology, Biomedical Institute for Convergence at SKKU (BICS), Sungkyunkwan University School of Medicine) , Kim, KyeongJin (Department of Biomedical Sciences, College of Medicine, Inha University) , Lee, Sang Bae (Division of Life Sciences, Jeonbuk National University)

Abstract ▼ AI-Helper

Skin aging appears to be the result of overlapping intrinsic (including genetic and hormonal factors) and extrinsic (external environment including chronic light exposure, chemicals, and toxins) processes. These factors cause decreases in the synthesis of collagen type I and elastin in fibroblasts and increases in the melanin in melanocytes. Collagen Type I is the most abundant type of collagen and is a major structural protein in human body tissues. In previous studies, many products containing collagen derived from land and marine animals as well as other sources have been used for a wide range of purposes in cosmetics and food. However, to our knowledge, the effects of human collagen-derived peptides on improvements in skin condition have not been investigated. Here we isolate and identify the domain of a human COL1A2-derived protein which promotes fibroblast cell proliferation and collagen type I synthesis. This human COL 1A2-derived peptide enhances wound healing and elastin production. Finally, the human collagen alpha-2 type I-derived peptide (SMM) ameliorates collagen type I synthesis, cell proliferation, cell migration, and elastin synthesis, supporting a significant anti-wrinkle effect. Collectively, these results demonstrate that human collagen alpha-2 type I-derived peptides is practically accessible in both cosmetics and food, with the goal of improving skin condition.

주제어

AI 본문요약
AI-Helper

* AI 자동 식별 결과로 적합하지 않은 문장이 있을 수 있으니, 이용에 유의하시기 바랍니다.

문제 정의

However, the effects of human collagen-derived peptides on improvements in skin condition have not been investigated. In this study, we found that a human-derived collagen peptide improves skin condition, supporting the practical applicability of this peptide in cosmetic and food compositions.

제안 방법

To confirm whether the protein was actually purified recombinant hCOL1A2 (SMC), we performed in an in-gel digest with trypsin and analyzed the peptides by liquid chromatography– mass spectrometry (LC/MS).
4A and 4B, scratch closure occurred more quickly in the presence of hCOL1A2 (SMM) compared to TGF-β1 and the negative control (NC). We examined the wound closure assay and statistically analyzed the data which derived from captured images at least five field in three independent experiments (Fig. 4B). At 20 hours of incubation, the wound closure rate of the cells showed 75-90% by hCOL1A2 (SMM) treatment, while the control group showed less than 60%.

대상 데이터

(D) Identification of hCOL1A2 (SMM) protein in the gel band of isolated hCOL1A2 (SMM) by LC-MS/MS analysis. The panels show the representative MS/MS spectrum for the identified peptides of GEQGPPGPPGFQGLPGPSGPAGEVGKPGER (2810.373 m/z, +2).

데이터처리

A student’s t-test was used for statistical analyses (*P ＜ 0.05, **P ＜ 0.005).
The student’s t-test was used for statistical analyses (*P ＜ 0.05).
The student’s t-test was used for statistical analyses (*P ＜ 0.05, **P ＜ 0.005).

이론/모형

(B) HDF cells were treated with hCOL1A2 (SMM) (1, 10, 100 μg/ml) and TGF-β1 (5 ng/ml) for 48h. Cell proliferation was determined by MTT assay. (C, D) HDF cells were treated with EGF (0.

The amount of collagen Type I was measured by ELISA in HDF cultured media (C). Cell proliferation, which was induced by EGF and hCOL1A2 (SMM), was determined by MTT assay (D). Results are mean ± SEM of three independent experiments.

성능/효과

In contrast, treatment of the collagen peptides or derivatives such as a hCOL1A2 (SMM) provides the anti-skin aging effect through collagen expression/activation (collagen chain trimerization) and activation of TGF-β signal pathway (37). In conclusion, the human collagen alpha-2 type I-derived peptide (SMM) enhances collagen type I and elastin synthesis, cell proliferation, and cell migration, supporting a significant anti-wrinkle effect. Additionally, hCOL1A2 (SMM) might be induced by relating hydroxylases such as previously developed collagen derivatives to supporting the anti-skin aging effect.

본문요약 정보가 도움이 되었나요? 예 아니오

참고문헌 (41)

1 El-Domyati M Attia S Saleh F 2002 Intrinsic aging vs. photoaging: a comparative histopathological, immuno-histochemical, and ultrastructural study of skin Exp Dermatol 11 398 405 10.1034/j.1600-0625.2002.110502.x 12366692

상세보기

2 Ganceviciene R Liakou AI Theodoridis A Makrantonaki E Zouboulis CC 2012 Skin anti-aging strategies Dermatoendocrinol 4 308 319 10.4161/derm.22804 23467476

상세보기

3 Rendon MI Gaviria JI 2005 Review of skin-ligh-tening agents Dermatol Surg 31 886 889 10.1111/j.1524-4725.2005.31736 16029683

상세보기

4 Petit L Pierard GE 2003 Skin-lightening products revisited Int J Cosmet Sci 25 169 181 10.1046/j.1467-2494.2003.00182.x 18494898

상세보기

5 Kim WS Park BS Park SH Kim HK Sung JH 2009 Antiwrinkle effect of adipose-derived stem cell: activation of dermal fibroblast by secretory factors J Dermatol Sci 53 96 102 10.1016/j.jdermsci.2008.08.007 18829265

상세보기

6 Kim J Kang S Kwon H Moon H Park MC 2019 Dual functional bioactive-peptide, AIMP1-derived peptide (AdP), for anti-aging J Cosmet Dermatol 18 251 257 10.1111/jocd.12671 29921010

상세보기

7 Edgar S Hopley B Genovese L Sibilla S Laight D Shute J 2018 Effects of collagen-derived bioactive pep-tides and natural antioxidant compounds on proliferation and matrix protein synthesis by cultured normal human dermal fibroblasts Sci Rep 8 10474 10.1038/s41598-018-28492-w 29992983

상세보기

8 van Zuijlen PP Ruurda JJ van Veen HA 2003 Collagen morphology in human skin and scar tissue: no adaptations in response to mechanical loading at joints Burns 29 423 431 10.1016/S0305-4179(03)00052-4 12880721

상세보기

9 Gelse K Poschl E Aigner T 2003 Collagens-struc-ture, function, and biosynthesis Adv Drug Deliv Rev 55 1531 1546 10.1016/j.addr.2003.08.002 14623400

상세보기

10 Singer AJ Clark RA 1999 Cutaneous wound healing N Engl J Med 341 738 746 10.1056/NEJM199909023411006 10471461

상세보기

11 Imanishi J Kamiyama K Iguchi I Kita M Sotozono C Kinoshita S 2000 Growth factors: importance in wound healing and maintenance of transparency of the cornea Prog Retin Eye Res 19 113 129 10.1016/S1350-9462(99)00007-5 10614683

상세보기

12 Park JS Kim JY Cho JY Kang JS Yu YH 2000 Epidermal growth factor (EGF) antagonizes transforming growth factor (TGF)-beta1-induced collagen lattice contraction by human skin fibroblasts Biol Pharm Bull 23 1517 1520 10.1248/bpb.23.1517 11145189

상세보기

13 Van Cauter E Plat L 1996 Physiology of growth hormone secretion during sleep J Pediatr 128 S32 37 10.1016/S0022-3476(96)70008-2 8627466

상세보기

14 Bartke A 2008 Growth hormone and aging: a challenging controversy Clin Interv Aging 3 659 665 10.2147/CIA.S3697 19281058

15 Sonntag WE Csiszar A deCabo R Ferrucci L Ungvari Z 2012 Diverse roles of growth hormone and insulin-like growth factor-1 in mammalian aging: progress and controversies J Gerontol A Biol Sci Med Sci 67 587 598 10.1093/gerona/gls115 22522510

상세보기

16 Sontakke SB Jung JH Piao Z Chung HJ 2016 Orally Available Collagen Tripeptide: Enzymatic Stability, Intestinal Permeability, and Absorption of Gly-Pro-Hyp and Pro-Hyp J Agric Food Chem 64 7127 7133 10.1021/acs.jafc.6b02955 27573716

상세보기

17 Watanabe-Kamiyama M Shimizu M Kamiyama S 2010 Absorption and effectiveness of orally administered low molecular weight collagen hydrolysate in rats J Agric Food Chem 58 835 841 10.1021/jf9031487 19957932

상세보기

18 Asserin J Lati E Shioya T Prawitt J 2015 The effect of oral collagen peptide supplementation on skin moisture and the dermal collagen network: evidence from an ex vivo model and randomized, placebo-controlled clinical trials J Cosmet Dermatol 14 291 301 10.1111/jocd.12174 26362110

상세보기

19 Inoue N Sugihara F Wang X 2016 Ingestion of bioactive collagen hydrolysates enhance facial skin moisture and elasticity and reduce facial ageing signs in a rando-mised double-blind placebo-controlled clinical study J Sci Food Agric 96 4077 4081 10.1002/jsfa.7606 26840887

상세보기

20 Konig D Oesser S Scharla S Zdzieblik D Gollhofer A 2018 Specific Collagen Peptides Improve Bone Mineral Density and Bone Markers in Postmenopausal Women-A Randomized Controlled Study Nutrients 10 97 10.3390/nu10010097 29337906

상세보기

21 Zdzieblik D Oesser S Baumstark MW Gollhofer A Konig D 2015 Collagen peptide supplementation in combination with resistance training improves body composition and increases muscle strength in elderly sarcopenic men: a randomised controlled trial Br J Nutr 114 1237 1245 10.1017/S0007114515002810 26353786

상세보기

22 Hu Z Yang P Zhou C Li S Hong P 2017 Marine Collagen Peptides from the Skin of Nile Tilapia (Oreochromis niloticus): Characterization and Wound Healing Evaluation Mar Drugs 15 102 10.3390/md15040102 28358307

상세보기

23 Minh Thuy le T Okazaki E Osako K 2014 Isolation and characterization of acid-soluble collagen from the scales of marine fishes from Japan and Vietnam Food Chem 149 264 270 10.1016/j.foodchem.2013.10.094 24295705

상세보기

24 Felician FF Xia C Qi W Xu H 2018 Collagen from Marine Biological Sources and Medical Applications Chem Biodivers 15 e1700557 10.1002/cbdv.201700557 29521032

상세보기

25 Wang B Wang YM Chi CF Luo HY Deng SG Ma JY 2013 Isolation and characterization of collagen and antioxidant collagen peptides from scales of croceine croaker (Pseudosciaena crocea) Mar Drugs 11 4641 4661 10.3390/md11114641 24284428

상세보기

26 Tanaka M Koyama Y Nomura Y 2009 Effects of collagen peptide ingestion on UV-B-induced skin damage Biosci Biotechnol Biochem 73 930 932 10.1271/bbb.80649 19352014

상세보기

27 Lee JK Kang SI Kim YJ 2016 Comparison of collagen characteristics of sea- and freshwater-rainbow trout skin Food Sci Biotechnol 25 131 136 10.1007/s10068-016-0020-z 30263248

상세보기

28 Trojanowska M LeRoy EC Eckes B Krieg T 1998 Pathogenesis of fibrosis: type 1 collagen and the skin J Mol Med (Berl) (Berl) 266 274 10.1007/s001090050216 9535560

상세보기

29 Chiquet M Matthisson M Koch M Tannheimer M Chiquet-Ehrismann R 1996 Regulation of extracellular matrix synthesis by mechanical stress Biochem Cell Biol 74 737 744 10.1139/o96-080 9164643

상세보기

30 Majora M Wittkampf T Schuermann B 2009 Functional consequences of mitochondrial DNA deletions in human skin fibroblasts: increased contractile strength in collagen lattices is due to oxidative stress-induced lysyl oxidase activity Am J Pathol 175 1019 1029 10.2353/ajpath.2009.080832 19661442

상세보기

31 Seo WY Kim JH Baek DS 2017 Production of recombinant human procollagen type I C-terminal pro-peptide and establishment of a sandwich ELISA for quanti-fication Sci Rep 7 15946 10.1038/s41598-017-16290-9 29162919

상세보기

32 Chen CZ Peng YX Wang ZB 2009 The Scar-in-a-Jar: studying potential antifibrotic compounds from the epigenetic to extracellular level in a single well Br J Pharmacol 158 1196 1209 10.1111/j.1476-5381.2009.00387.x 19785660

상세보기

33 Adelmann-Grill BC Wach F Cully Z Hein R Krieg T 1990 Chemotactic migration of normal dermal fibroblasts towards epidermal growth factor and its modulation by platelet-derived growth factor and transforming growth factor-beta Eur J Cell Biol 51 322 326 2351154

상세보기

34 Walter MN Wright KT Fuller HR MacNeil S Johnson WE 2010 Mesenchymal stem cell-conditioned medium accelerates skin wound healing: an in vitro study of fibroblast and keratinocyte scratch assays Exp Cell Res 316 1271 1281 10.1016/j.yexcr.2010.02.026 20206158

상세보기

35 Quan T Shao Y He T Voorhees JJ Fisher GJ 2010 Reduced expression of connective tissue growth factor (CTGF/CCN2) mediates collagen loss in chronologically aged human skin J Invest Dermatol 130 415 424 10.1038/jid.2009.224 19641518

상세보기

36 Seite S Zucchi H Septier D Igondjo-Tchen S Senni K Godeau G 2006 Elastin changes during chronological and photoageing: the important role of lysozyme J Eur Acad Dermatol Venereol 20 980 987 10.1111/j.1468-3083.2006.01706.x 16922949

상세보기

37 Liu Z Li Y Song H 2019 Collagen peptides promote photoaging skin cell repair by activating the TGF-beta/Smad pathway and depressing collagen degradation Food Funct 10 6121 6134 10.1039/C9FO00610A 31497829

상세보기

38 Fisher GJ Choi HC Bata-Csorgo Z 2001 Ultraviolet irradiation increases matrix metalloproteinase-8 protein in human skin in vivo J Invest Dermatol 117 219 226 10.1046/j.0022-202x.2001.01432.x 11511297

상세보기

39 Sugimoto K Nakamura T Tokunaga T 2018 Matrix metalloproteinase promotes elastic fiber degradation in ligamentum flavum degeneration PLoS One 13 e0200872 10.1371/journal.pone.0200872 30067795

상세보기

40 Chung JH Seo JY Choi HR 2001 Modulation of skin collagen metabolism in aged and photoaged human skin in vivo J Invest Dermatol 117 1218 1224 10.1046/j.0022-202x.2001.01544.x 11710936

상세보기

41 Martinotti S Ranzato E 2020 Scratch Wound Healing Assay Methods Mol Biol 2109 225 229 10.1007/7651_2019_259 31414347

이 논문을 인용한 문헌

연구과제 타임라인

LOADING...

LOADING...

LOADING...

LOADING...

LOADING...

표제어: PCR

동의어: Packet Collision Rate

용어 설명 출처 목록 (6)

용어 설명: PCR은 세균 특이성이 있는 primer를 이용하여 적은 수의 세균이 있을지라도 쉽게 검출할 수 있는 유용한 방법이며, 이를 이용하여 구강 내 치면세균막이나 타액에서 직접 세균을 검출할 수 있게 되었다[8].

내보내기 구분	파일저장 인쇄 메일전송
구성항목	기본정보 상세정보 관리번호, 논문명, 저널/프로시딩명, 저자 , 발행년, 권, 호, 시작페이지, 끝페이지, 발행기관 관리번호, 논문명, 대등논문명, 저자 , 저널/프로시딩명, 발행기관, 발행년, 발행언어, 권, 호, 시작페이지, 끝페이지, ISBN, ISSN, 주제분야, 키워드, 초록(한글), 초록(영문), 저자(소속기관)
저장형식	Text(ASCII format) Excel format RefWorks Direct Export RIS format (for Reference Manager, ProCite, EndNote), Scholar's Aids, Mendeley
메일정보	받는사람 (필수) @ 보내는사람 (선택) @ 제목 내용 KISTI 검색결과 이메일 서비스
안내	총 건의 자료가 검색되었습니다. 다운받으실 자료의 인덱스를 입력하세요. (1-10,000) 검색결과의 순서대로 최대 10,000건 까지 다운로드가 가능합니다. 데이타가 많을 경우 속도가 느려질 수 있습니다.(최대 2~3분 소요) 다운로드 파일은 UTF-8 형태로 저장됩니다. 파일의 내용이 제대로 보이지 않을실 때는 웹브라우저 상단의 보기 -> 인코딩 -> 자동선택 여부를 확인하십시오. ~ Text(ASCII format) Excel format

연합인증