보고서 정보
주관연구기관 |
연세대학교 Yonsei University |
보고서유형 | 최종보고서 |
발행국가 | 대한민국 |
언어 |
한국어
|
발행년월 | 2013-07 |
과제시작연도 |
2012 |
주관부처 |
농림축산식품부 Ministry of Agriculture, Food and Rural Affairs(MAFRA) |
등록번호 |
TRKO201400005727 |
과제고유번호 |
1545004172 |
사업명 |
고부가가치식품기술개발 |
DB 구축일자 |
2014-11-29
|
DOI |
https://doi.org/10.23000/TRKO201400005727 |
초록
▼
○ 연구결과
본 연구 과제에서는 UV 광촉매 살균 기술을 통하여 식품의 영양소나 품질의 손실을 최소화 하는 비열 살균 기술을 개발하고자 하였다.신선편이 식품에는 E.coli,S.aureus,Salmonella,B.cereus 등 다수의 미생물 검출된다는 문헌 검색 및 자료 조사가 이루어졌으며,이를 기반으로 brothtest를 통하여 자외선 살균력을 측정하였다.자외선 파장별 살균력을 측정한 결과,파장이 가장 짧은 UVC로 처리하였을 때,감균 속도와 세포벽의 손상도가 최대로 나타났으며,단 시간 내에 최대 살균 효율을 갖는 UVC가
○ 연구결과
본 연구 과제에서는 UV 광촉매 살균 기술을 통하여 식품의 영양소나 품질의 손실을 최소화 하는 비열 살균 기술을 개발하고자 하였다.신선편이 식품에는 E.coli,S.aureus,Salmonella,B.cereus 등 다수의 미생물 검출된다는 문헌 검색 및 자료 조사가 이루어졌으며,이를 기반으로 brothtest를 통하여 자외선 살균력을 측정하였다.자외선 파장별 살균력을 측정한 결과,파장이 가장 짧은 UVC로 처리하였을 때,감균 속도와 세포벽의 손상도가 최대로 나타났으며,단 시간 내에 최대 살균 효율을 갖는 UVC가 비가열 처리 공정에 가장 적합하였다.UV 광촉매 기술로 미생물을 처리할 경우,많은 양의 유리 라디칼이 생성되어 위해 미생물의 DNA,RNA,단백질과 지질을 손상시켜 자외선 단일 처리보다 더욱 강한 감균 효과(1.5logCFU/cm2)을 보였다.
신선초 주스와 당근 주스를 pilot-scaleUV 광촉매 반응기로 처리한 결과,저장 기간 8일 동안 대조군에 비하여 0.8log의 감균 효과가 있었으며,품질 변화는 대조군과 거의 차이가 없었다.액체 시료를 UV 광촉매 살균 기술을 적용 시킨 결과,자외선 노출 면적이 증가할수록,시료의 유속이 느릴수록 살균력이 증가하는 것이 관찰되었다.살균 대상의 색이 진할 경우와 탁도가 높을 경우는 시료가 자외선을 흡수하여 투과도가 현저히 저하되고 살균 효과가 감소하는 것이 관찰되었다.
탁도가 높은 신선초,당근의 경우,초기 균수를 감소시킬 수 있는 전처리 세척 과정이 필요하며 batch식 UV 광촉매 살균기를 개발하여 전처리 세척 과정을 적용시켰다.전처리 세척 과정을 적용시킨 결과 추가적으로 1.0log의 감균 효과를 보였다.
Batch식 자외선 광촉매 반응기와 초음파 조사법을 병용하여 처리한 결과,병합처리가 예상보다 낮은 균 감소율을 보였고 추가적인 살균 효과를 보이지 않았다.이것은 광촉매의 라디칼 형성을 초음파 에너지가 간섭하여 저해를 일으켰거나 초음파 에너지가 자외선 광자의 이동에 영향을 주었기 때문으로 사료되었다.결론적으로 자외선 광촉매 처리는 신선편이 식품의 표면 살균에서 큰 효율을 보였고 현장 시스템에도 도입이 가능한 것으로 사료된다.
초음파와 살균소독제를 처리하여 미생물 사멸 효과 및 품질 변화를 측정한 결과,broth,suschip, 양상추에서 초음파 및 살균소독제를 병용처리 한 경우에는 초음파 또는 소독제만을 단독으로 사용했을 때보다 시너지 효과가 나타나는 것을 알 수 있었다.또한,Invitro에서보다 Infood에서 감소효과 및 시너지 효과가 높게 나타났으며,broth보다 suschip 또는 양상추 표면에서의 감소효과 및 시너지 효과가 높게 나타났다.이는 초음파가 살균력 보다는 detachment효능을 가지기 때문인 것으로 사료된다.양상추에 초음파-살균소독제를 병용 처리한 결과 신선편이 식품의 당도,pH,조직감 등의 품질 변화는 대조군과 유의적 차이가 없었으나,색도 L,a,b값 모두 초음파와 살균소독제의 처리 조건이 증가할수록 값이 증가하였다.하지만 L값과 b값의 변화는 살균소독제의 영향 때문인 것으로 사료되며 a값의 변화는 초음파와 살균소독제 모두의 영향인 것으로 사료된다.
최적의 병용처리 조건을 갖춘 장비를 pilotscale의 현장 적용시켜 보았다.양상추를 pilotscale의 초음파-소독제 장비에 적용된 초음파-소독제 동시처리 결과 총 균수,E.coli,B.cereus의 미생물 수가 최대 1log이상의 감소를 보였으며,품질변화는 대조군과 거의 차이가 없었다.일반적인 양상추 가공 공정의 순서 중 초음파-소독제 처리를 이용할 수 있는 소액체 시료를 UV 광촉매 살균 기술을 적용 시킨 결과, 자외선 노출 면적이 증가할수록,시료의 유속이 느릴수록 살균력이 증가하는 것이 관찰되었다.살균 대상의 색이 진할 경우와 탁도가 높을 경우는 시료가 자외선을 흡수하여 자외선의 투과도가 현저히 저하되어 살균 효과가 감소하는 것이 관찰되었다.이러한 결과들을 바탕으로 초음파 및 살균소독제의 병용처리는 화학적 살균소독제인 염소계 소독제의 처리 농도를 저감화 시킬 수 있고,초음파 처리 시간을 단축시킴으로써 물리적인 충격에 노출을 줄여 신선편이 식품의 상품적 가치를 유지할 수 있을 것으로 사료된다.
저온플라스마를 이용한 식품살균시스템을 개발하고자 감압방전플라스마(LPDP),유전체장벽방전플라스마(DBDP),코로나방전플라스마제트(CDPJ)등 3 종류의 플라스마 생성장치를 제작하여 기계특성,살균력을 검정하고 식품품질에 미치는 영향을 조사하였다.LPDP 생성에 적합한 감압조건은 절대압력 1.0Torr이었고,살균력은 출력에 비례하였으며,생성기체별 살균효과는 질소 > 공기 > 산소플라스마 순으로 우수하였다.DBDP 살균효과는 전류세기에 비례하였으며,전극간격에 따라서는 2.65mm > 3.33mm > 1.85mm 순이었다.최소 D'-값은 전극간격 2.65mm,전류세기 1.25A에서 0.565min이었다.또한 이동식 처리가 고정식 처리에 비해 살균력이 유의하게 높았고,이동식 처리방식 간에는 양방향 처리가 단일방향 처리에 비해 살균효과가 우수하였다.CDPJ의 살균효과는 LPDP와 DBDP보다 우수하였고,살균력은 전류에 비례하였으며,토출거리에 따른 살균력은 25mm > 15mm > 35mm 순으로 높은 살균효과를 보였다.
저온플라스마를 이용하여 식품을 살균시킨 결과,생식제조용 백미와 현미에 대한 살균력은 CDPJ가,압맥은 DBDP가 가장 양호하였다.균주별로는 세균이 진균보다 플라스마 살균에 민감하였으나, Bacillus는 저항성이 높았고,곡류의 외관,색도,산가,TBA가는 플라스마 처리에 의해 크게 영향을 받지 않았다.새싹의 일반세균은 107 CFU/g 수준이었으며 대장균군,살모넬라,바실러스,포도상구균,리스테리아 등 식중독균도 103 – 106 CFU/g 수준으로 오염되어 비가열 살균 기술의 적용이 필요하였다.플라스마 종류별 새싹의 살균효과는 CDPJ> DBDP > LPDP 순으로 살균력이 높았다.김의 경우도 살균력이 CDPJ> DBDP > LPDP 순이었으며,저온플라스마 처리는 김의 외관,색도,항산화 능에 영향을 미치지 않았다.
저온플라스마를 이용하여 현장에 적용시킨 결과,살균대상 식품의 크기와 모양에 제약을 받지 않고 대량 처리가 가능한 저온플라스마장치로 원격코로나방전플라스마제트(R-CDPJ)시스템을 고안하고 실증적 살균실험을 수행하였다.R-CDPJ살균의 D'-값은 3.307- 4.990h로 살균 소요시간은 길었으나 처리용량의 제한이 없고 품질 저하가 없었다.곡류,과채류,해조류 등을 24hR-CDPJ처리한 결과 2log수준의 미생물 감소효과가 있었으며 품질변화는 거의 없어 플라스마 살균의 현장적용 모델로 적합하였다.
UV 광펄스를 이용하여 신선 식품의 표면을 살균시켜 보았다.Externaltriggering방식을 통해 소규모,소량화된 광펄스 처리장치를 제작하였다.마른 김에 존재하는 방사선 저항세균 Micrococcus roseus와 병원성 대장균 E.coliO157:H7의 광펄스 살균효과를 확인한 결과 M.roseus,E.coli O157:H7에 모두 높은 살균효과를 보였고,실제 김에 적용하였을 경우에도 1.6log 이상의 사멸효과를 나타냈다.파프리카를 광펄스로 처리하였을 경우,93%의 총 균수 감소효과가 있었으며,firmness의 강도 증가,vitaminC 함량이 증가하는 결과를 나타내었으며,그 외에도 폴리페놀 수요함량 등을 감소하는 결과를 나타내었으나 특별한 품질의 변화는 보이지 않았다.
저온 플라스마와 UV 광펄스 병합 처리에 의한 미생물 저감 효과를 관찰한 결과,새싹 채소를 광펄스 처리하였을 경우 병원성 대장균은 98%의 감균 효과를 나타내었으며,저온플라스마와 병합하였을 경우 더욱 높은 살균효과를 보여 향후 농수산물의 비가열 살균 방법으로 가능성을 보였다.
Acid의 종류와 농도에 따른 아염소산수 생성농도와 순도를 확인한 결과 아염소산수의 생성 효율은 유기산 중 phosphoric acid 8%와 NaClO2 8%를 반응시켰을 때 생성효율이 가장 좋았고,아염소산수의 순도는 산의 종류 및 농도와 관계없이 96-98% 사이로 나타나 산의 종류 및 농도와 아염소산수 순도 사이에는 상관관계가 없는 것으로 판단되었다.
아염소산수를 농도별(100,200,300,400 ppm)로 제조하여 jetnebulizer와 ultrasonic nebulizer로 분무하여 가스농도측정기로 시간별 농도를 측정한 결과 jetnebulizer는 5- 15분 사이에 가장 높은 농도를 나타내었으며,ultrasonicnebulizer는 60-80분 사이에 가장 높은 농도를 나타내었다.각 농도별로 jetnebulizer는 3,5,7,9ppm을 나타내었고,ultrasonicnebulizer는 9,21,34,44ppm을 나타내었다.JetNebulizer의 입자크기는 20- 50㎛로 ultrasonicnebulizer는 0.5- 13㎛로 확인되었고,분무 전후의 pH는 다소 감소하였다.
Jetnebulizer와 ultrasonicnebulizer의 살균력 차이 확인을 위해 귤과 피망의 표면에 Samonella Typhimurium을 접종하여 아염소산수를 분무하여 처리한 결과 jet nebulizer보다 ultrasonic nebulizer의 살균력이 뛰어난 것으로 나타났다.식용 가능한 소재를 이용한 제형별 나노 입자의 크기를 측정한 결과 cellulose,gelatin,lecithin,pectin의 모든 소재에서 대상 천연 항균제인 자몽 종자의 경우 나노 입자 지름 크기가 200nm 이하,고추냉이 300nm 이하,도인 200nm 이하,발효더덕 200nm 이하의 크기로 제조된 것을 확인할 수 있었으며,전자 현미경(EF-TEM)측정을 통하여 모든 나노 입자의 형태가 구형의 형태로 제조된 것을 확인해 본 연구를 통해 제안된 입자화 공정이 활용성이 높은 것으로 평가된다.
제조된 나노 입자들의 안정성을 평가를 위해 ζ-potential을 측정한 결과 천연 항균제에 관계없이 전체 pH 범위에서 높은 전위차를 나타내 상당한 안정성을 유지하는 것이 확인되었다.단지 높은 염기성의 경우 안정성이 다소 감소하는 경향을 나타냈으나 이 수용액에 최소 농도의 안정제를 첨가하면 이 경우도 나노 입자의 안정성을 증진시킬 수 있을 것으로 사료된다.
제조된 천연 추출물 나노입자의 항균 활성을 측정한 결과 자몽 종자와 고추냉이를 이용한 천연 나노 항균제의 항균 활성이 높게 나타나,식용 가능한 천연 나노 항균제를 식품에 직접 적용이 가능하며,화학적 항균제를 대신하여 보다 안전하고 뛰어난 항균 증진이 가능할 것으로 사료된다.또한 나노 입자 형태로 제조된 천연 항균제의 관능적 평가 결과 그 고유의 천연 활성을 포함할 뿐 아니라 식품에서 가장 중요한 맛과 향에 영향을 주지 않아 식품의 천연 항균제로써 상용이 가능할 것으로 사료된다.
천연 항균 나노 입자화 연구 결과들은 기존의 천연 항균제들을 식품에 사용했을 시에 가장 문제가 되고 있는 고농도 사용,잔류성,식용 사용 입자 소재 선택에 따른 봉입 효율 저하,냄새 등의 문제점들의 해결이 가능할 것이라는 결론을 도출했다.또한 나노 입자의 항균 작용 원리나 기작에 관한 기초 결과를 얻어 다양한 분야에 활용이 가능할 것으로 예측된다.
비가열 살균기술로 나노입자 분무공정을 현장 적용하기 위해 천연 추출물과 산성화 아염소산수를 ultrasonicnebulizer로 분무 처리하여 살균력을 확인한 결과,ultrasonicnebulizer를 이용하여 당근, 파프리카,감귤 표면에 접종된 E.coliO157:H7,S.Typhimurium,L.monocytogenes에 대해 최대 400ppm의 산성화 아염소산수를 분무하여 30분 처리하였을 때 실험 균주 전체에서 2-3log 이상의 살균효과를 확인할 수 있었으며,신선편이 식품에서 외관적 품질 지표로 중요한 탈색 및 백화 현상과 같은 색의 변화는 나타나지 않았다.
미산성 저농도 전해수의 살균 효능 분석에서 위해 미생물의 저감화를 위한 물리적 전처리 조건을 확립하였다.미산성 전해수 생성 최적 조건을 확립하기 위해 전처리를 검토하여 invitro실험을 통해 검증한 결과,전류량을 1.45A로 올리고,PCB 전극의 개수를 3개로 늘려 미산성 전해수를 제조하였을 때 전극의 미생물 저감효과가 가장 높은 것으로 나타났으며,미산성전해수의 유효염소농도(ACC)별로 저감효과를 확인할 결과 10ppm일 때 가장 높은 저감화를 보였으며 5ppm에서도 5log 이상의 감소를 나타났다.
양배추와 돼지고기를 대상으로 하여 미산성전해수 연구를 수행하였다.미산성 저농도 전해수나 강산성 전해수의 식품 내 다양한 matrix속에 존재하는 총 균수를 저감화 하는 것이 접종한 식중독균보다 저감화 효과가 감소하는 것으로 나타났다.돼지고기에 침지시간과 미산성전해수의 차아염소산농도별로 처리하였을 때 총 균수의 저감효과를 나타내었다.돼지고기가 양배추에 비하여 유기물이 훨씬 많기 때문에 전해수의 살균효과를 감소시킨 것으로 기인하여 미산성전해수나 강산성 전해수 모두 살균력이 떨어지는 것으로 나타났다.미산성 저농도 전해수 살균소독력 평가 결과 침지시간이 증가함에 따라 살균효능이 증가하였고,미산성 저농도 전해수의 농도가 높을수록,온도가 증가할수록 살균효능이 증가하는 것을 알 수 있었다.
품질변화의 최소화를 위해 미산성 저농도 전해수의 최적 농도,온도를 설정하였다.최적 농도와 온도를 설정한 미산성 전해수와 초음파 병용 처리한 생식원료는 위해미생물 저감화에 효과가 있었다.
각각 다른 저장온도에서 미산성 전해수와 초음파를 병용 처리한 생식원료가 대조군 보다 균수의 증가율이 낮고,이화학적 변화가 적었다.미산성 전해수와 초음파 병용 처리한 생식원료를 이용한 위해 미생물 예측모델 개발을 통해 위해평가에 이용할 수 있었다.
신선편이식품에 aqueous ClO2 처리를 적용한 시료의 저장 중 품질 변화 분석한 결과,aqueous ClO2는 염소보다 2.5배 높은 산화력과 5배 높은 살균력을 가지면서 발암성분을 형성하지 않는 장점을 가지고 있었으며,aqueousClO2를 당근,레드치커리,청경채 등 신선편이식품에 처리한 결과,색도나 관능평가에 큰 변화 없이 호기성 세균은 1.20-3.07logCFU/g의 감균 효과를 보였으며,효모 및 곰팡이는 0.63-3.09log CFU/g의 감소효과가 나타났다.또한,electronbeam 처리는 식품에 방사능을 유발하지 않고 처리 시간이 짧으며,처리 후 식품의 온도 변화가 거의 없으면서도 처리 효과가 높은 친환경적인 수단이다.aqueous ClO2를 치콘,적근대,다채,메밀싹에 단일 처리한 결과,호기성 세균은 1.40-2.54logCFU/g,효모 및 곰팡이는 0.50-3.36 log CFu/g의 감소를 보였고,electro beam과 병합 처리 시,모든 처리 구에서 호기성 세군과 효모 및 곰팡이가 검출 되지 않았다.
자외선 조사는 미생물 내의 핵산 성분이 화학변화를 일으켜 대사 장해를 가져와 증식 능력을 잃게 되는 원리로 식품가공공정에 적용 시 거의 변화를 주지 않고,조사 후 잔존하지 않는 장점을 가지고 있다.메밀 싹에 aqueous ClO2와 UVC 병합 처리 시,색도와 품질의 변화 없이 호기성 세균은 3.58 log CFU/g,효모 및 곰팡이는 1.91 log CFU/g이 감소하여 미생물 수 감소에 효과적이었으며, aqueous ClO2,electronbeam,UVC 등의 병합 살균 처리는 기존의 차아염소산나트륨 등 염소계 살균제 또는 오존 단일 살균 처리의 문제점을 보완하고 위생적 품질을 유지할 수 있다.Aqueous ClO2, electron beam,UVC 등이 병합된 hurdle technology 처리는 신선편이식품의 고품질을 유지하면서 미생물학적 안전성을 향상시키는데 효과적인 방법으로 사료된다.
이산화탄소 배출량 평가를 위해 기존에 주로 사용하는 방법인 환경부 LCA법은 제조 공정 모든 단계의 inventory 중 총 기여도가 50% 미만인 항목을 제외하고 평가하는 방법으로서 식품제조 및 유통 중의 이산화탄소 배출량을 정확하게 평가하기에는 문제가 있는 것으로 판단된다.
본 연구에서도 무균포장법의 경우 hybridLCA법에 의해 평가된 가공법 제조 및 유통과정 중 발생되는 총 이산화탄소 배출량이 환경부 LCA법을 사용하게 되면 식품의 종류에 따라서는 식품제조 공정 중 배출되는 실제 이산화탄소의 양보다 낮게 평가될 가능성이 있을 것으로 나타났다.하지만 Hybrid LCA법은 ProcessLCA법과 IO LCA법에 의해 평가된 이산화탄소 발생량을 합한 값으로서 두 가지 방법에 의한 평가를 보완할 수 있다.
주요 식품 가공 단위공정에 대하여 공정인자가 이산화탄소 발생량에 미치는 영향을 평가하고자 대표적인 단위공정인 살균공정(sterilization)에 대하여 온도와 시간에 따른 이산화탄소 발생량을 예측해 본 결과,살균온도 상승에 따른 CO2 발생량은 선형적으로 증가하였고 살균기준온도가 높을수록 에너지 소모량은 증가하나 살균효과를 고려할 때 오히려 높은 온도에서 단시간 처리할수록 에너지 소모량은 더 효율적이었다.스낵제조 공정 중 에너지 소모량인 큰 dough의 건조공정에 대하여 에너지 사용과 관련된 airflow와 열분석을 실시한 결과,건조공정에서의 CO2 배출량은 건조조건에 큰 영향을 받는 것으로 나타났다.
광펄스 가공기술,저항열처리 가공기술,초고압 가공기술을 적용한 모델식품의 살균 효과 검증을 통해 검토하였으며,기존 공정과 비교하여 이산화탄소 배출량을 비교․평가하였고 식품제조공정에서 기존의 살균기술을 대체 적용함에 따른 이산화탄소 저감화 가이드라인을 제시하였다.또한,열처리 공정을 대체하는 비가열 기술에 대하여 비교․분석하여 실제 국내에서 적용하고 있는 초고압 기술을 열처리 대체기술로 선정하였다.국내외에서 초고압 기술을 저온 살균의 대체 기술로 활용하고 있는 업체는 약 45개 업체로 국내에서는 대기업 2곳과 중소기업 2곳으로 모두 천연주스를 생산하는 업체로 조사되었다.
현장 적용을 위하여 천연 cloudy 시과주스 제조 공정의 분석 및 시제품의 품질(미생물학적 안정성,영영 성분,기능 성분 및 포장 용기 등)을 검토하였고,LCA를 실시하기 위한 평가 범위를 선정하였다.본 공정에 대한 에너지 저감 효과와 탄소저감 효과를 추산하여 단순히 저온살균공정만 비교해 보면 초고압 처리에서는 843.5 MJ(168.7 kJ/kg),기존 가열 살균공정(HTST)에서는 2,371 MJ(474.2kJ/kg)로 두 공정의 차이가 매우 극명하게 나타났으며,탄소 저감 효과는 평가 범위에서 약 90%로 추산되었다.하지만 실제 측정값에 대한 자료는 업체의 정보 비공개로 인하여 제시하지 못하였다.초고압 기술을 적용한 천연 cloudy 사과주스 제조 공정의 환경 보호 부대효과로서 용수 사용 최소화와 부산물 생성을 억제할 수 있음이 확인되었다.현장 적용 분석결과,탄소 저감화는 식품산업에서의 당면 문제이고 이를 위해서는 LCA와 같은 분석과 동시에 이루어져야 한다.
Abstract
▼
Ⅳ. Research result
○ The first detail subject: Development of neuraminidase-inhibitor-based anti-viral & remedial biological material
“Application study for development and commercialization of biological material KW-100 for virus infection control”
※ Biological material for virus infection
Ⅳ. Research result
○ The first detail subject: Development of neuraminidase-inhibitor-based anti-viral & remedial biological material
“Application study for development and commercialization of biological material KW-100 for virus infection control”
※ Biological material for virus infection control as a result of examining influenza virus neuraminidase-inhibitor from various biological materials – the Year-1 deliverable from technology transfer “Development of diversity of KW-100 through registration & sales of various products using KW-100 as part of the way to manufacture and commercialize KW-100, the biological material for virus infection control.
I. Virus detection & medicine development technology
1. Main ingredient: KW-100 is curcumin [1,7-Bis(4-hydroxy-3-methoxyphenyl)-1,6-heptadiene-3,5-dione] of natural material (Curcuma longa, ウユン), a derivate of curcuminoids which is used for food coloring and additives.
2. Benefits and effects:
1) Anti-virus effect: Extract and fraction of KW-100 containing vitality to inhibit hemmaglutinin and neuraminidase involved in virus reproduction was developed, which proved to have superior preventive and remedial effect against the virus H1N1 (Spanish Influenza), H1N1 (novel influenza) and H9N2 (virus from domestic chicken) as a result of lab test and also against influenza virus type A [A/NWS/33 (H1N1) and A/PR/8/34 (H1N1)] as a result of animal model test. Particularly, KW-100 proved to have superior remedial effect against the virus (H9N2) from domestic chicken as a result of SPF chicken model test..
• Anti-virus vitality of KW-100, extract and fraction
Viewing the bioactivation inhibiting effect of KW-100, extract and fraction against Spanish influenza virus (H1N1)-derived neuraminidase (NA) from 【Table 1】 below, KW-100, extract and fraction proved to have superior inhibiting vitality against neuraminidase.
Viewing【Table 2】 below, (KW-100) extract and fraction proved to have superior virucidal and cytopathic inhibiting effect against A/H1N1(Spain influenza-derived virus) and A/HS/K5/01(H9N2, virus from domestic chicken) which shows it directly works on hemmaglutinin which is virus surface antigen before the cell is infected by virus for virucidal effect, proving the usefulness against influenza virus.
Recently it verified its virucidal effect and cytopathic inhibiting effect against new flu. As a result of testing virucidal effect and cytopathic inhibiting effect after responding influenza virus (103.0EID50/mL) A/H1N1 and KW-100 for an hour at 4℃, influenza virus inhibiting effect in cell was proved at 30 mM 【Table 3, 4】
Viewing 【Table 5】 below, KW-100 proved to have superior effect against influenza virus type
A [A/NWS/33 (H1N1)와 A/PR/8/34 (H1N1)] as a result of mouse model test. When it comes to A/NWS/33 (H1N1), all mice in positive control group died in 8 days after infection, while no mouse died in a group treated by KW-100 and a clinical sign (fur became rough, slow response) appeared 4 days later and the weight in 7 days was reduced by 6.2g in positive control group while the weight loss of a group treated with KW-100 was 2.1g only. In case of A/PR/8/34 (H1N1), all mice in positive control group died in 8 days after infection, while no mouse died in a group treated by KW-100. In conclusion, KW-100 proved its superior virucidal effect as a result of animal test.
• Verification of antivirus vitality using KW-100 & KW-100/ST-100* cocktail medicine SPF chicken
As a result of monitoring the influenza virus reproduction inhibiting effect after preventive & remedial injecting KW-100 from 7 days till 5 days after vaccination, virus re-separation rate and mean factor from the group treated with 10 mg/kg appeared to be lower than the vaccinated group 【Table 6】.\
ST-100 solubilizing agent to improve bioabsorption effect of KW-100 was developed and KW-100/ST-100 cocktail medicine was manufactured and after preventive & remedial injecting KW-100 from 7 days till 5 days after vaccination to SPF chicken, influenza virus reproduction inhibition effect was measured.
Consequently, virus re-separation rate and mean factor from the group treated with 10 mg/kg appeared to be lower than the vaccinated group 【Table 7】.
In case of KW-100/ST-100 cocktail medicine, it reduced the virus re-separation titer to trachea when treating with KW-100 alone, while reduced significantly cecal tonsil virus re-separation titer along with increasing KW-100 absorption rate when treating with cocktail medicine. Consequently, using natural solubilizing agent ST-100를increased the bioabsorption rate of antivirus biological material, KW-100.
• Verification of vitality of infected animals by various KW-100 products (Nano KW-100 & Lipo KW-100)
Anti-viral effect of Nano-KW-100 made by adding Nano material to KW-100 to increase the absorption rate to the body and Lipo-KW-100 melted using liposome on infected mouse animal model was verifie.
After died or the test was finished, the main target of influenza, the lung of the mouse was
taken and the cell was homogenized before extracting RNA from the supernatant liquid after
centrifugation and virus excretion period was examined using pirmer pair by real-time RT-PCR
method. As a result, virus tilter of the group injected by Nano KW-100 & Lipo KW-100 was
reduced to the half of other group without injection. Though no significant difference
depending on dose, Nano KW-100 reduced virus excretion more than Lipo KW-100.
• Effect of KW-100 acidic disinfectant: Benzalkonium chloride, citric acid, phosphoric acid and KW-100, Lamia-Kill®
Published bacteria and virus share: General bacteria strain Samonella typhymurium (G-B-14-21-62), Specific bacteria strain Brucella ovis (63/290), major poultry disease virus, Avian influenza virus H9N2 (MS96 strain), major pig disease virus, Swine hog choleara virus (LOM strain), and Newcastle disease virus SNU 4152 strain (Velogenic strain)\
Lamia-Kill ® is acidic disinfectant containing Benzalkonium chloride, citric acid, phosphoric acid.
Citric acid is organic acid is free from toxicity and corrosivity, but stable and is used for food and drinks. Phosphoric acid is used as food additives and is also used as disinfectant of cooking device. Benzalkonium is excitant and low toxicity to mammal but is used as disinfectant widely because of not affected by temperature and pH. Disinfection effect of Lamia-Kill ® containing KW-100 includes the followings.
Disinfection effect of KW-100 acidic disinfectant Lamia-Kill® against Foot & mouth disease virus (FMDV) is the result of the test by Pirbright Lab in UK, which proved the disinfection effect at 1/1000 dilution rate, indicating the disinfection effect as much as twice the existing disinfectant with same component
KW-100 acidic disinfectant Lamia-Kill® W-100 has been approved for manufacture and quality control by the Ministry of Food, Agriculture, Forestry and Fisheries Permit No 195)
II. The study for application using antivirus biological material KW-100
1. Main ingredient: Cocktailed at optimal mixing ratio and density for applying KW-100, KW (material of KW-100), ST-100 and ST (material of ST-100) for production
2. Study for applying to chicken farm:
1) Improving origin rate and feed efficiency: when injecting KW/ST cocktail medicine (KW : ST = 3 : 7), the weight of the group treated with cocktail medicine was increased 60g more than control group till 6 weeks then the weight was slightly decreased than the control group because of increased active mass since 8 weeks, but no significance. When it comes to mortality rate, no significant different between the control group and the group treated with cocktail medicine [Fig-3].
2) Disease treatment effect of cocktail medicine: To identify the disease treatment effect on Korean chicken (5 weeks old), accumulated mortality rate and symptom were checked under three experiment conditions
In case of group C for feeding and spraying cocktail medicine on floor to eliminate the virus and treating with disinfectant to prevent the virus, no mortality rate since day 7, indicating superior effect compared to the control group and when viewing visual symptom of disease, the chicken which caught the disease had a liver inflammation and pericardial hydropsy. Mortality rate is significantly increased due to infection combined by adenovirus, infectious anemic virus and Gumboro virus. But in case of treated group (Group C), Korean chicken caught the disease was recovered to normal liver in a week
3. The study for application to leg lobster farm
1) Improving origin rate and feed efficiency: Lobster farming for the purpose of increasing the valyu of commodities was made for 117 days using test product KW/ST cocktail medicine (KW : ST = 5 : 5) The weight of lobster was 40g in maximum and 25g on average and 44/kg on average, which was 3.0g more than the ordinary saleable. The difference in weight comparing to ordinary lobster was more than 8, indicating higher investment value, and when irt comes to feed efficiency, 4.6% higher than control group.
2) Disease treatment effect of cocktail medicine: When it comes to white spot syndrome virus (WSSV), ordinary feeds to control group while feeding KW/ST cocktail medicine to experimental group (cocktail medicine/feed, 10/90) before monitoring. As a result, control group died all in 3 days while experimental group recorded 20% mortality rate in 7 days and 30% in 10 days
4. The study for application to eel farming
1) Improving origin rate and feed efficiency: Viewing feed intake, gain rate, weight gain and feed conversion ration (FCR) and feeding rate (%), experimental group with KW/ST cocktail medicine (KW : ST = 3 : 7) 0.3% and 0.5% recorded 92.2g and 92.6g, respectively, in terms of fain rate.
while control group indicated 50.8g and in case of feed conversion ratio (FCR), control group was 1.41 while control group treated with KW/ST cocktail medicine 0.3% and 0.5% was 1.25 and 1.18, respectively, proving high improvement effect. The final weight of eel was 650g in maximum and 400g on average and 2.5 fishes/kg on average, while control group indicated 4.5 fishes/kg and experimental group treated with KW/ST cocktail medicine was 2.5 fishes/kg
2) Water purification effect by KW/ST cocktail medicine: As a result of visual inspection, the substance in test device had less suspended solids than those in control group. Suspended solid in control group was 95 mg/L and in experimental group was 16.0 mg/L, indicating 6 times more in control group, and when it comers to chemical oxygen demand, control group was double the experimental group. Such result proved assorted feed containing cocktail medicine has superior effect to improve the water quality.
○ The first cooperative subject: Development of Glycosidase inhibitor-based anti-AI lead compound
1. Examination of Neuraminidase inhibitor from sophora root and identification of lead structure
2. Neuraminidase inhibitory substances of mangosteen
3. Neuraminidase inhibitory substances of Amorpha fruticosa L.and structure analysis
4. Neuraminidase inhibitory substances from Lespedeza bicolor and lead structure
5. Neuraminidase inhibitory substances from Paeonia lactiflora
6. Neuraminindase inhibitory substances of Angelica keiskei
7. Neuraminidase inhibitory substances from Flemingia philippinensis
8. Molecular modeling of selected Neuraminidase inhibitor’s lead structure Molecular docking simulations were carried out by using GOLD(Genetic Optimization for Ligand Docking, http://www.ccdc.cam.ac.uk/Solutions/GoldSuite/Pages/GOLD.aspx)
○ The second cooperative subject: Establishment & examination of CBA system for developing M2
channel inhibitor
I. Production of expressed cell strain for establishing M2 channel activity verification system
(1) Securing M2 channel gene
• M2 channel CDS (294 bp)
atgagtcttc taaccgaggt cgaaacgcct atcagaaacg aatgggggtg cagatgcaac ggttcaagtg atcctctcac
tattgccgca aatatcattg ggatcttgca cttgacattg tggattcttg atcgtctttt tttcaaatgc atttaccgtc gctttaaata
cggactgaaa ggagggcctt ctacggaagg agtgccaaag tctatgaggg aagaatatcg aaaggaacag cagagtgctg
tggatgctga cgatggtcat tttgtcagca tagagctgga gtaa
• M2 channel protein (97 a.a)
MSLLTEVETPIRNEWGCRCNGSSDPLTIAANIIGILHLTLWILDRLFFKCIYRRFKYGLKGGPSTEGVPKSMREEYRKEQQSAVDADDGHFVSIELE
(2) Analysis of expression location in cell of M2 channel
▶ Observing expression in cell after tagging gree fluorescence protein to N-, C- terminal of M2 channel
(3) Electrophysiologic analysis of M2-IRES-GFP
▶ Instead of tagging GFP directly to M2 channel, electrical activity of M2 channel was measured using IRES-GFP, which is bicistronic expression vector and is able to express M2 channel and GFP simultaneously in same vector so as to easily confirm the expression of M2 channel
▶ As a result, in pH7.4, M2-IRES-GFP didn’t show electrical expression as control but in pH5.5, significant increase in inward current in negative potential was monitored
▶ Through cell image test and electrophysiological test, M2-IRES-GFP proved to be suitable as CBA system to examine M2 channel inhibitor.
(4) M2 channel expression vector analysis result
(5) Establishment of M2-IRES-GFP expressed cell strain
▶ M2-IRES-GFP gene was injected into HEK293 cell to establish stable cell which expresses M2-IRES-GFP and was cultivated by culture media containing neomycin before separating individual clone
▶ Then 2 kinds of stable cell line which were similar with control cell in cell type and cycle were secured among selected clones
II. Production of expressed cell strain for establishing M2 channel activity verification system and implementation of activity verification test
(1) Analysis of inhibition ability of wild type M2 channel by Amantadine
▶ After injecting wtM2-IRES-GFP gene into HEK293 cell strain, inhibition ability by amantadine was proved using electrophysiological test.
▶ With fluorescence microscope, cell in which GFP is expressed was selected (B) and the test
(C) was conducted in Whole-cell patch mode.
▶ While holding cell membrane voltage at 0 mV, rapid inward current by M2 channel appeared when changing to pH 5.5 solution from pH 7.4
▶ It’s also confired that M2 channel activated by pH 5.5solution was inhibited by 100 μM amatadine process
▶ Hence, wild type M2 channel appeared to be appropriate in examining M2 channel inhibitor.
A stable cell was structured by injecting vector (wtM2-IRES-GFP) which expresses this gene into HEK293 cell strain.
(2) Examination of M2 channel inhibitor using natural substance library
- To identify wtM2 channel inhibitor, electrophysiological analysis of lead compound received from the first detail cooperative subject was carried out to M2 channel inhibitor.
- After receiving 8 kinds of structural transducer of M2 channel inhibitor lead material Ka-23 from the first cooperative subject team, Professor Park, Kee-hoon team, M2 channel inhibition ability was confirmed.
- As a result of reviewing the effect of 8 kinds of structural transformer of M2 channel inhibitor Ka-23 on activation of M2 channel using electrophysiological test, all of 8 kinds didn’t have effect in inhibiting activation of M2 channel.
▶ Our team also confirmed the effect of biological index material on activation of M2 channel.
▶ As a result, candidate biological material and index material had no effect at all inhibiting the activation of M2 channel
○ The second detail subject: Development of medicine to prevent and remedy virus infected inflammation
1) Development & operation of new activation verification system targeting cell adhesion molecule involving in virus-infected inflammation.
• Establishment and operation of ICAM-1/LFA-1 binding inhibitor examination system: Two assay systems were developed to examine binding inhibitor of ICAM-1/LFA-1.After establishing In vitro binding assay and cell to cell binding assay, examination to seek binding inhibitor of ICAM-1/LFA-1 was carried out by screening 400 kinds of medicinal plant extracts. Briefly describing In vitro binding assay, after coating sICAM-1 on well plate, fluorescence intensity of THP-1 cell which was adhered by adding THP-1 cell expressing VLA-4 was measured. For Cell to cell binding assay, adhesion of CHO cell and THP-1 cell was monitored using CHO cell expressing ICAM-1, instaed of ICAM-1 sICAM-1.
Development & operation of VCAM-1/VLA-4 binding inhibitor examination system: As similar with ICAM-1/LFA-1 binding inhibitor examination system, after coating sVCAM-1 on well plate, fluorescence intensity of THP-1 cell which was adhered by adding THP-1 cell expressing VLA-4 was measured. When it comes to ICAM-1/LFA-1 binding inhibitor examination system, CBR LFA-1/2 antibody which is able to activate LFA-1 to induce bindig response between ICAM-1 and LFA-1, but no activation process is required for binding VCAM-1 and VLA-4
• Establishment and operation of Sialic sugar chain and selectin binding inhibitor examination system: After coating L-selectin on 96-well plate, fluorescence intensity of the cell adhered by adding sialic THP-1 or HL-60 cell expressing sugar chain.
2) Identifying, separating & refining biological material with superior cell adhesion molecule inhibition activity
• Identification of biological material Evodiafructus with superior binding inhibition activity of ICAM-1/LFA-1: Evodiafructus methanol (MeOH) extract showed 40%inhibition activity in 50 μg/mL concentration and after adding solvent with water and ethyl acetate (EtOAc), it showed a 70% superior binding inhibition activity in 50 μg/mL concentration. Active compound indicating ICAM-1/LFA-1binding inhibition activity was isolated in ethyl acetate layer and was identified by NMR. As seen in figure below, 4 kinds of Quinolon alkaloids compound were isolated at ethyl acetate layer and 2 and 4 of them showed binding inhibition activity of ICAM-1/LFA-1, particularly compound 4 showed high inhibition activity. Such result was published on Bull. Korean Chem. Soc in 2010.
• Identification of biological material with superior inhibition activity of ICAM-1 and VCAM-1: In cell adhesion by ICAM-1/LFA-1, Zingiber officinale roots methanol (MeOH) extract showed 42% cell adhesion inhibition activity in 30 μg/mL concentration and after adding solvent with water and ethyl acetate, ethyl acetate layer showed 65% and 30% cell adhesion inhibition activity in 30 and 10 μg/mL concentration, respectively. Zingiber officinale roots methanol extract showed superior inhibition activity in cell adhesion by VCAM-1/VLA-4. After separating 9 kinds of phenolic compounds from Zingiber officinale roots, cell adhesion activity was checked. The most superior inhibition activity was monitored from bonding between active compound 4 ICAM-1/LFA-1 and VCAM-1/VLA-4. Such result was published on Food Chem in 2011.
• Identification of biological material with superior L-selectin inhibition activity: As a result of verifying L-selectin inhibition activity of the compound separated from 50 kinds of herb medicine extract and herb medicine, saikosaponins separated from bupleurum showed superior inhibition activity. Particularly IC50 value of saikosaponin A and D (50% inhibiting concentration) was 3.5 and 15.6 μM respectively, while no inhibition activity appeared in saikosaponin b3, b4, C.
• Several compounds with superior inhibition activity were isolated and from alpiniae
katsumadali and rhubarb: Ak2 and Ak3, which is acyclic triterpenoid series compound, with superior VCAM-1/VLA-4 bonding inhibition activity were isolated and refined. Ak-2 showed 44.5% inhibition activity in 10 μg/mL concentration in cell adhesion by VCAM-1/VLA-4 bonding. HJK-1, 2, 3 & 4 with superior ICAM-1/LFA-1 bonding inhibition activity were isolated from knotweed (HJK) and quantitative and qualitative analysis was conducted. Stilbenese with superior ICAM-1/LFA-1 bonding inhibition activity was isolated from rhubarb and refined. The result was published on Arch. Pharm. Res in 2012.
3) Establishment and operation of TLR7/8 examination system recognizing Single strand RNA and identification of stimulative agent
• Identification of KR-300 biological material with superior TLR7/8 inhibition activity: TLR7/8 is the pattern-recognition receptor in cell whi ch recognizes virus-origin single strand RNA. It’s intended to develop KR-300 extract inhibiting TLR7/8 and identify the action for inhibiting TLR7/8 by KR-300이 TLR7/8.
• Isolating KR-301 from KR-300 and identifying KR-301 action: Separating several compounds from KR-300 extracts and identifying the target in cell and action of KR-301 with superior TLR7/8 inhibition activity.
4) Verification of identified material from animal model and antiviral effect of the compound
against influenza virus
• Verification of protection effect of HJK-1 compound isolated from knotweed: HJK-1 among stilbenes isolated from knotweed has the most superior cell adhesion inhibition activity and as a result of injecting Influenza virus type A/NWS/33 (H1N1) into BALB/c mouse and testing protection effect against influenza virus, HJK-1 slightly reduced the mortality rate by influenza virus in 300 mg/kg concentration without significant effect. 10 mice in positive control group were died all while 8 mice in HJK-1-injected group were died Ÿ Verification of KR-300 protection effect: After injecting Influenza virus type A/NWS/33 (H1N1) into BALB/c mouse with KR-300 ethanol extract, antiviral effect test against influenza was carried out and as a result, 10 mice in positive control group were all died while only 3 mice were died among the group injected by KR-300 in 200 mg/kg concentration, showing superior protection effect. Better effect was monitored when injecting both KW100 and KR-300 together and KR-100 concentration was 100 mg/kg than 200 mg/kg.
• Verification of protection effect of KR-301 isolated from KR-300: As a result of testing antiviral effect of KR-301 alone against influenza, 10 mice were all died in positive control group while 8 mice died among the group injected by KR-301 alone indicating insignificant effect of a single compound and thus the extract such as KR-300 would be better than a single compound as candidate antiviral material against avian influenza.
○ The third cooperative subject: Verification of bioactivity of AI preventive & remedial biological material and identification of candidate material
I. Activity verification of KW-100 AI-preventive & remedial biological material with animal model
(1) Test method
- Test of genesistasis effect of KW-100 on high pathogenic influenza virus
- Test of genesistasis effect of mixed KW-100 & KW-200 on high pathogenic influenza virus
- Test of clinical symptom and fatality rate reduction effect of KW-100 on high pathogenic influenza virus-infected SPF BALB/C mice
- Test of clinical symptom and fatality rate reduction effect of mixed KW-100 & KW-200 on high pathogenic influenza virus-infected SPF BALB/C mice
- Test of clinical symptom and fatality rate reduction effect of KW-100 on high pathogenic influenza virus-infected SPF chicken
(2) Test result
(A) Test of test tube genesistasis effect of selected 3 candidate material
- The test of effect of KW-100 on high pathogenic influenza virus (plaque reduction assay) was carried out. 2X MEM batch containing high pathogenic influenza (H5N1) virus (103.0EID50/ml) and 1% agarose and KW-100 by concentration level was mixed and cultured for 2 days at 37℃ and minimal concentration to have antiviral effect was confirmed through plaque. As a result, KW-100 in concentration 42ug/ml reduced plaque number by more than 50% comparing to positive control group, proving the reduction of high pathogenic influenza virus.
- The test to identify the effect of antiviral candidate material KW-100+KW200 on influenza virus (plaque reduction assay) was carried out. 2X MEM batch containing high pathogenic influenza (H5N1) virus (103.0EID50/ml) and 1% agarose and KW-100 by concentration level was mixed and cultured for 2 days at 37℃ and minimal concentration to have antiviral effect was confirmed through plaque. As a result, KW-100 in concentration 42ug/ml reduced plaque number by more than 50% comparing to positive control group, proving the reduction of high pathogenic influenza virus
- The test to identify the effect of antiviral candidate material KW-100(DMSO) on influenza virus (plaque reduction assay) was carried out. 2X MEM batch containing high pathogenic influenza (H5N1) virus (103.0EID50/ml) and 1% agarose and KW-100 by concentration level was mixed and cultured for 2 days at 37℃ and minimal concentration to have antiviral effect was confirmed through plaque. As a result, KW-100(DMSO) in concentration 42ug/ml reduced plaque number by more than 50% comparing to positive control group, proving the reduction of high pathogenic influenza virus.
(B) Anti-influenza effect of 3 kinds of candidate material on mouse
- Anti-influenza effect of candidate material, KW-100 and KW-100+KW-200 on SPF BALB/c mouse was tested. 3 kinds of antiviral candidate material was oral medicated once a day (200ul/mouse/day) by group from 7 days before injecting high pathogenic influenza (H5N1) virus till 14 days after injecting. PBS was orally mediated to positive control group and negative control group same as test group. And clinical symptom and fatality rate were monitored for 3 weeks after injecting. As a result, positive control group without treatment after injecting high pathogenic influenza virus died 100% while survival rate of the group injected by KW-100 및 KW-100(DMSO) without treatment after injecting high pathogenic influenza virus was 10%.
(C) Anti-influenza effect of 3 kinds of candidate material on chicken
- Anti-influenza effect of candidate material, KW-100 and KW-100+KW-200 on SPF chicken was tested. 3 kinds of antiviral candidate material was oral medicated once a day (2ml/chicken/day) by group from 7 days before injecting high pathogenic influenza (H5N1) virus till 7 days after injecting. PBS was orally mediated to positive control group and negative control group same as test group. And clinical symptom and fatality rate were monitored for 10 days after injecting. As a result, positive control group without treatment after injecting high pathogenic influenza virus died 100% while survival rate of the group injected by KW-100 without treatment after injecting high pathogenic influenza virus was 10% and the group injected by mixed KW-100(DMSO) and KW-100+KW-200 was 20%.
○ Participating enterprises: Developing antiviral feed additives & medicines using KW-100
I. Development of technology-transferred antiviral biological material KW-100 and feed additive using cocktail medicine (KW/ST*)
(2) Antiviral feed additive upgrade considering economical feasibility and distribution
- Final cocktail ratio for domestic fowl: KW-100/ST-100 = 5:5 for production
- Final cocktail ratio for fish: KW-100/ST-100 = 3:7 for production
(3) Development of various products using cocktail medicine and registration of feed
(4) Development of antiseptic using antiviral bio material KW-100 and permit
- For permit with antiseptic using virus infection control bio material KW-100 as licensed drug, manufacture & quality control permit from Animal & Plant Quarantine Agency (Permit No 195)
II. Sales status of technology-transferred KW-100 and cocktail medicine (KW/ST)
목차 Contents
- 표지 ... 1
- 제출문 ... 2
- 요약문 ... 3
- SUMMARY ... 17
- CONTENTS ... 33
- 목 차 ... 40
- 제 1장 연구개발과제의 개요 ... 46
- 제 2장 국내외 기술개발 현황 ... 48
- 제 3장 연구 개발 수행 내용 및 결과 ... 53
- 제 1절 UV-광촉매 산화 및 초음파 살균소독제 병용 처리를 이용한 세척 살균 ... 53
- 제 2절 저온 플라스마와 UV 광펄스를 이용한 식품 표면 살균 ... 145
- 제 3 절 신선 편이식품의 보존성,안전성 증진을 위한 천연/화학 항균제의 고효율 나노 살균 공정 개발 ... 263
- 제 4절 미산성 저농도 전해수의 살균 효능 ... 357
- 제 5절 비가열처리 가공공정의 현장 적용 탄소저감 시스템 개발 ... 507
- 제 4장 목표달성도 및 관련분야의 기여도 ... 581
- 제 5장 연구개발 성과 및 성과활용 계획 ... 607
- 제 6장 연구개발과정에서 수집한 해외과학기술정보 ... 621
- 제 7장 연구시설·장비 현황 ... 628
- 제 8장 참고문헌 ... 629
- 끝페이지 ... 638
※ AI-Helper는 부적절한 답변을 할 수 있습니다.